DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30098 and CG18420

Sequence 1:NP_725573.2 Gene:CG30098 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_995715.1 Gene:CG18420 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster

Alignment Length:274 Identity:98/275 (36%)
Similarity:150/275 (55%) Gaps:26/275 (9%)


  Fly     1 MTPAIVLLTFLVILTLGSYGYSQLLDSKCIALFRI----RVIGGQNARR--TPWMAYL-IRDNRF 58
            |...::|||...:|     |.:|.|||:|.....:    |::.|:.|.|  :||||:| ...|:|
  Fly     8 MASILLLLTVFPLL-----GSTQFLDSECGTRSPLKLGPRIVNGKVAVRNSSPWMAFLHTSSNQF 67

  Fly    59 ACGGSLIAYRFVLTAAHCTKINDNLFVRLGEYDSSRTTDGQTRSYRVVSIYRHKNYIDFRNH--D 121
            .|||:||:.|.|||||||...|..:.||||||  :|...|....::|...::|:.| |...|  |
  Fly    68 ICGGTLISRRLVLTAAHCFIPNTTIVVRLGEY--NRKLKGYREEHQVNRTFQHRFY-DPNTHAND 129

  Fly   122 IAVLKLDRQVVYDAYIRPICILLNSGLQSLANSIQNFTLTGWGQMAHYYKMPTTLQEMSLRRVRN 186
            ||:|:|...|||.|.||||||:.::..:...:||:..|.||||:....:. .:.|:.:.:.|..:
  Fly   130 IALLRLVSNVVYKANIRPICIMWDASWKHHIDSIKVLTGTGWGRTESMHD-SSELRTLDISRQPS 193

  Fly   187 EYC---GVPSLSICCWNPVQYACFGDSGGPLGSLVKYGHKTIYVQFG--VTNSVTGNCDGYSSYL 246
            :.|   .|.|...|..|.....|.||:|||:|::|:|.:...:||.|  :||.   .|...|.:.
  Fly   194 KMCAFGSVLSNQFCAGNWNSNLCIGDTGGPVGAMVRYRNAFRFVQVGIAITNK---RCQRPSVFT 255

  Fly   247 DLMSYMPWLYQTLL 260
            |:||::.::.:..|
  Fly   256 DVMSHIEFIRRIFL 269

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 86/228 (38%)
Tryp_SPc 37..258 CDD:238113 85/231 (37%)
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 86/229 (38%)
Tryp_SPc 43..267 CDD:238113 85/231 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C159549155
eggNOG 1 0.900 E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_133884
Panther 1 1.100 P PTHR24260
RoundUp 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.