DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30098 and CG33225

Sequence 1:NP_725573.2 Gene:CG30098 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001286682.1 Gene:CG33225 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster

Alignment Length:279 Identity:91/280 (33%)
Similarity:146/280 (52%) Gaps:32/280 (11%)


  Fly     5 IVLLTFLVILTLGS-YGYSQLLDSKCIAL---FRI-RVIGGQNARR--TPWMAYLIRDNRFACGG 62
            ||||..||   ||: .|.|.||.:.|...   .|| ||:||.:|.|  .|||..::.:|...|.|
  Fly    23 IVLLASLV---LGARLGSSTLLTNDCGTTRHPSRIRRVVGGNDADRFANPWMVMVLGENNVFCSG 84

  Fly    63 SLIAYRFVLTAAHCTKINDNLFVRLGEYDSSRTTDGQTRSYRVVSIYRHKNYIDF-----RNHDI 122
            |||...||||:|.|. ::....|.|||||.:.|:...|...:|:.|.:...:..|     :.:||
  Fly    85 SLITRLFVLTSASCL-LSLPKQVILGEYDRNCTSADCTSIRQVIDIDQKIIHGQFGLETVKKYDI 148

  Fly   123 AVLKLDRQVVYDAYIRPICILLNSGLQSLANSIQNFTLTGWGQMAHYYKMPTTLQEMSLRRVRNE 187
            |:|:|.::|....|:||||:.::   :.:..|:|:||.|||| ...:.:..|.||.::|.::..:
  Fly   149 ALLRLAKKVSISDYVRPICLSVD---RQVGRSVQHFTATGWG-TTEWNEPSTILQTVTLSKINRK 209

  Fly   188 YC------GVPSLSICCWNPVQYACFGDSGGPLGSLV------KYGHKTIYVQFGVTNSVTGNCD 240
            ||      .:.:..:|...|.:..|.||:||||...:      |:.:|:.....|:.:..:.:|.
  Fly   210 YCKGRLRQNIDASQLCVGGPRKDTCSGDAGGPLSLTLKIDGDGKWNNKSRAFLIGIVSYGSSSCS 274

  Fly   241 GYSSYLDLMSYMPWLYQTL 259
            |...|.::..||.|:.:|:
  Fly   275 GIGVYTNVEHYMDWIVRTI 293

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 74/237 (31%)
Tryp_SPc 37..258 CDD:238113 74/240 (31%)
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 75/238 (32%)
Tryp_SPc 57..292 CDD:238113 74/240 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_133884
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.800

Return to query results.
Submit another query.