DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30098 and CG33458

Sequence 1:NP_725573.2 Gene:CG30098 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_995854.2 Gene:CG33458 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster

Alignment Length:282 Identity:99/283 (35%)
Similarity:151/283 (53%) Gaps:26/283 (9%)


  Fly     1 MTPAIVLLTFLVILTLG---SYGYSQLLDSKC-IALFRIRVIGGQNA--RRTPWMAYLIRDNRFA 59
            :.||:     |.:|.||   |.|||.||:..| |:.:..|:.||:::  ...||:|||..:::|.
  Fly     3 LIPAL-----LALLILGHGISLGYSYLLEWDCGISKYTYRITGGRDSPLMLNPWLAYLHINSKFI 62

  Fly    60 CGGSLIAYRFVLTAAHCTK-INDNLFVRLGEYDSSRTTD-------GQTRSYRVVSIYRHKNYID 116
            |||||:.:.||||||||.: .|..:.|||||.|:|:..|       .....|.::....|..|..
  Fly    63 CGGSLLNHWFVLTAAHCFRDKNAKVLVRLGENDASQKIDCNESECAAPHLEYMIMQKLIHPLYRT 127

  Fly   117 FRNHDIAVLKLDRQVVYDAYIRPICILLNSGLQSLANSIQNFTLTGWGQMAHYYKMPTTLQEMSL 181
            ...:|||:.||:|.|||...|||||::||...|...::|:.|.:|||| ..:..::...||...:
  Fly   128 AHYYDIALAKLNRYVVYTDSIRPICLMLNPNWQVYVDTIRYFIITGWG-ATNASEVSDKLQLTRI 191

  Fly   182 RRVRNEYCG------VPSLSICCWNPVQYACFGDSGGPLGSLVKYGHKTIYVQFGVTNSVTGNCD 240
            .::....|.      |....||......|...|||||||||:|.|.:...:.|||:.:.:.....
  Fly   192 PQIDRFTCRYWFGYMVDRTHICAGESKHYVGKGDSGGPLGSMVDYKYAKRFFQFGIVSHLRQPFH 256

  Fly   241 GYSSYLDLMSYMPWLYQTLLRN 262
            |.|.:.:::||..|:::|::.|
  Fly   257 GVSVFTNILSYSNWIHRTIITN 278

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 82/234 (35%)
Tryp_SPc 37..258 CDD:238113 82/237 (35%)
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 83/235 (35%)
Tryp_SPc 38..274 CDD:238113 82/237 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_133884
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.800

Return to query results.
Submit another query.