DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30098 and CG30288

Sequence 1:NP_725573.2 Gene:CG30098 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001097398.1 Gene:CG30288 FlyBaseID:FBgn0050288 Length:282 Species:Drosophila melanogaster

Alignment Length:278 Identity:86/279 (31%)
Similarity:130/279 (47%) Gaps:36/279 (13%)


  Fly     5 IVLLTFLVILTLGSYGYSQLLDSKCIAL----FRIRVIGGQNA--RRTPWMAYLIRDNRFACGGS 63
            ||...|:.|:...|   .:||::.|...    :|.|:.||::|  ...|||..::...:..||||
  Fly    10 IVACLFIGIIRTES---GRLLENDCGTTSSNGYRARIDGGRDAGMESNPWMVRVMISGKAVCGGS 71

  Fly    64 LIAYRFVLTAAHCTK---INDNLFVRLGEYDSSRTTDG------QTRSYRVVSIYR---HKNYID 116
            ||..||||||.||..   :|    |||||||:......      ..|:|. |.:.|   |.|   
  Fly    72 LITARFVLTAEHCISPMYMN----VRLGEYDTRHPIFDCDDFVCTPRAYN-VDVDRKIVHSN--- 128

  Fly   117 FRNHDIAVLKLDRQVVYDAYIRPICILLNSGLQSLANSIQNFTLTGWGQMAHYYKMPTTLQEMSL 181
             ..:||.:|::.|.|::..|:||||::|...|.....||..|..||||..:...:. ..||..:|
  Fly   129 -PGYDIGLLRMQRSVIFSNYVRPICLILGKTLGGNPLSILRFNFTGWGTNSDGEEQ-DRLQTATL 191

  Fly   182 RRVRNEYCGVPSLS-----ICCWNPVQYACFGDSGGPLGSLVKYGHKTIYVQFGVTNSVTGNCDG 241
            :::....|..|...     ||..:.:..:|.|||||||.::..:..:....||||.:.....|.|
  Fly   192 QQLPQWSCERPGRPLDISYICAGSYISDSCKGDSGGPLSAIRTFEGQGRVFQFGVASQGLRLCSG 256

  Fly   242 YSSYLDLMSYMPWLYQTL 259
            ...|.::..:..|:...:
  Fly   257 LGIYTNVTHFTDWILDVI 274

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 76/237 (32%)
Tryp_SPc 37..258 CDD:238113 76/240 (32%)
CG30288NP_001097398.1 Tryp_SPc 42..270 CDD:214473 77/238 (32%)
Tryp_SPc 45..270 CDD:238113 76/235 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_133884
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.800

Return to query results.
Submit another query.