DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30098 and CG30286

Sequence 1:NP_725573.2 Gene:CG30098 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster

Alignment Length:285 Identity:87/286 (30%)
Similarity:136/286 (48%) Gaps:46/286 (16%)


  Fly     5 IVLLTFLVILTLGSYGYSQLLDSKC-----IALFRIRVIGGQNAR------RTPWMAYLIRDNRF 58
            |:|||.|  |....:..:|.|:..|     .||        ||..      .:||||||.:....
  Fly     4 ILLLTSL--LPWHPHATAQFLEPDCGYMSPEAL--------QNEEHQAHISESPWMAYLHKSGEL 58

  Fly    59 ACGGSLIAYRFVLTAAHCTKINDNLFVRLGEYDSSRTTD-------GQTRSYRVVSIYRHKNYI- 115
            .|||:|:.:||:||||||.:.::||.|||||::|..:.|       ..:..:.:...:||..|. 
  Fly    59 VCGGTLVNHRFILTAAHCIREDENLTVRLGEFNSLTSIDCNGSDCLPPSEDFEIDVAFRHGGYSR 123

  Fly   116 DFRNHDIAVLKLDRQVVYDAYIRPICILLNSGLQSLANSIQNFTLTGWGQMAHYYKMPTTLQEMS 180
            ..|.|||.:|:|.:.|.|..:|:|||::.|:.||.....:.....||||      :.|:......
  Fly   124 TNRIHDIGLLRLAKSVEYKVHIKPICLITNTTLQPKIERLHRLVATGWG------RSPSEAANHI 182

  Fly   181 LR--RVRNEYCGVPSLS---------ICCWNPVQYACFGDSGGPLGSLVKYGHKTIYVQFGVTNS 234
            |:  ||.....||.|.:         ||..:....:|.||||||:|..::...:.::||.|:.:.
  Fly   183 LKSIRVTRVNWGVCSKTYWVDRRRDQICVSHESGVSCSGDSGGPMGQAIRLDGRVLFVQVGIVSY 247

  Fly   235 VTGNCDGYSSYLDLMSYMPWLYQTL 259
            ....|...|.:.::|.::.|:...|
  Fly   248 GNAECLSPSVFTNVMEHIDWIMAAL 272

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 74/243 (30%)
Tryp_SPc 37..258 CDD:238113 75/246 (30%)
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 73/236 (31%)
Tryp_SPc 39..268 CDD:214473 73/235 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C159549297
eggNOG 1 0.900 E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24260
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.