DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30098 and CG30090

Sequence 1:NP_725573.2 Gene:CG30098 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_725487.1 Gene:CG30090 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster

Alignment Length:284 Identity:101/285 (35%)
Similarity:145/285 (51%) Gaps:26/285 (9%)


  Fly     1 MTPAIVLLTFLVILTLGSYGYSQLLDSKC------IALFRIRVIGGQNA--RRTPWMAYLIRDNR 57
            |..||..:|.|.|..|.|.|..:.|:.:|      ||   .::|||::|  ...|||||:....:
  Fly     1 MWGAIAAITALAIGVLCSLGNGEYLEPRCGLTANTIA---FKIIGGRDAIINSNPWMAYIHSSVK 62

  Fly    58 FACGGSLIAYRFVLTAAHCTKINDNLFVRLGEYDSSRTTDGQTR-------SYRVVSIYRHKNYI 115
            ..|||:||..|||||||||......:.|||||||.:.|.|..::       .:.|...:||..:.
  Fly    63 LICGGTLITQRFVLTAAHCVNEGSAVKVRLGEYDDTATEDCNSKICIPRAEEHDVDMAFRHGKFS 127

  Fly   116 DFRN-HDIAVLKLDRQVVYDAYIRPICILLNSGLQSLANSIQNFTLTGWGQMAHYYKMPTTLQEM 179
            :.:| :|||:|:|.:.|.:.|:|.||||:|.:..:.|.:||:.|..||||: ...::....||..
  Fly   128 EIKNLNDIALLRLAKFVTFKAHISPICIILGTSKRELVDSIEWFVATGWGE-TRTHRTRGVLQIT 191

  Fly   180 SLRRVRNEYCG------VPSLSICCWNPVQYACFGDSGGPLGSLVKYGHKTIYVQFGVTNSVTGN 238
            .|:|..:..|.      |....||........|.|||||||...|::..|...|||||.:..:..
  Fly   192 QLQRYNSSQCMQALGRLVQQNQICAGRLGSDTCNGDSGGPLFQTVRHMDKMRPVQFGVVSYGSRE 256

  Fly   239 CDGYSSYLDLMSYMPWLYQTLLRN 262
            |.|...|.|:.||..|:...:.:|
  Fly   257 CSGIGVYTDVYSYADWIATVVQQN 280

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 86/234 (37%)
Tryp_SPc 37..258 CDD:238113 87/237 (37%)
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 87/235 (37%)
Tryp_SPc 40..276 CDD:238113 87/237 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C159549192
eggNOG 1 0.900 E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_133884
Panther 1 1.100 P PTHR24260
RoundUp 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.