DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30098 and CG30087

Sequence 1:NP_725573.2 Gene:CG30098 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_725489.2 Gene:CG30087 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster

Alignment Length:262 Identity:82/263 (31%)
Similarity:131/263 (50%) Gaps:28/263 (11%)


  Fly    22 SQLLDSKCIALFR----IRVIGGQNA--RRTPWMAYLIRDNRFACGGSLIAYRFVLTAAHCTKIN 80
            :|.|:..|...:.    :||:.|:.|  |..|:|.|:..::...||||::..|::||||||  :.
  Fly    23 AQFLNPLCGVTYESQTAMRVVNGKEAVIRSAPFMVYVTNNSLTHCGGSILNSRYILTAAHC--VF 85

  Fly    81 DNLFVRLGEYDSSRTTDGQ-------TRSYRVVSIYRHKNYIDFRNH--DIAVLKLDRQVVYDAY 136
            .||.:||||::.....|.|       :..|.::....|:.| :..||  |||:|||:|.:.::.:
  Fly    86 PNLRLRLGEHNIRTDPDCQGSNCSPRSEEYGIMKAITHRFY-NAANHVNDIALLKLNRSINFNVH 149

  Fly   137 IRPICILLNSGLQSLANSIQNFTLTGWGQMAHYYKMPTTLQEMSLRRVRNEYCG------VPSLS 195
            |:|||||||   .:.|.|:..:...|||: ......|..||...||.....||.      :....
  Fly   150 IQPICILLN---PASAPSVATYQTFGWGE-TKKNGFPHLLQTAELRAYDAAYCSRSFHAYMNGNQ 210

  Fly   196 ICCWNPVQYACFGDSGGPLGSLVKYGHKTIYVQFGVTNSVTGNCDGYSSYLDLMSYMPWLYQTLL 260
            ||..:..:..|.|||||||.:.|.:.....|:|.|:.:....:|.....|..:.:|:.|:.:.:|
  Fly   211 ICAGHEERDTCAGDSGGPLVTRVDFDGVKRYLQLGIVSYGPTDCQSPGVYTYVPNYINWIRRAML 275

  Fly   261 RN 262
            .|
  Fly   276 IN 277

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 76/235 (32%)
Tryp_SPc 37..258 CDD:238113 76/238 (32%)
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 77/236 (33%)
Tryp_SPc 42..272 CDD:238113 76/237 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C159547776
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_133884
Panther 1 1.100 P PTHR24260
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.