| Sequence 1: | NP_725573.2 | Gene: | CG30098 / 246456 | FlyBaseID: | FBgn0050098 | Length: | 264 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001247121.1 | Gene: | CG43335 / 12798413 | FlyBaseID: | FBgn0263040 | Length: | 281 | Species: | Drosophila melanogaster |
| Alignment Length: | 269 | Identity: | 96/269 - (35%) |
|---|---|---|---|
| Similarity: | 136/269 - (50%) | Gaps: | 25/269 - (9%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 10 FLVILT----LGSYGYSQLLDSKC-----IALFRIRVIGGQNARRT--PWMAYLIRDNRFACGGS 63
Fly 64 LIAYRFVLTAAHCTKINDNLFVRLGEYDSSRTTDGQ-----TRSYRVVSIYRHKNYI-DFRNHDI 122
Fly 123 AVLKLDRQVVYDAYIRPICILLNSGLQSLANSIQNFTLTGWGQMAHYYKMPTTLQEMSLRRVRNE 187
Fly 188 YC------GVPSLSICCWNPVQYACFGDSGGPLGSLVKYGHKTIYVQFGVTNSVTGNCDGYSSYL 246
Fly 247 DLMSYMPWL 255 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG30098 | NP_725573.2 | Tryp_SPc | 36..254 | CDD:214473 | 84/231 (36%) |
| Tryp_SPc | 37..258 | CDD:238113 | 84/233 (36%) | ||
| CG43335 | NP_001247121.1 | Tryp_SPc | 41..272 | CDD:214473 | 84/232 (36%) |
| Tryp_SPc | 42..275 | CDD:238113 | 84/233 (36%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45463452 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E33208_3BQ4K | |
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0000404 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 1 | 0.900 | - | - | OOG6_108863 | |
| Panther | 1 | 1.100 | - | - | P | PTHR24260 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X21 | |
| 7 | 6.740 | |||||