DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30098 and CG43335

Sequence 1:NP_725573.2 Gene:CG30098 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001247121.1 Gene:CG43335 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster

Alignment Length:269 Identity:96/270 (36%)
Similarity:136/270 (50%) Gaps:25/270 (9%)


  Fly    10 FLVILT----LGSYGYSQLLDSKC-----IALFRIRVIGGQNARRT--PWMAYLIRDNRFACGGS 63
            ||||::    |..:|.|:||:..|     .:..|.|:|||.:|..|  ||||||..:..:.|.|:
  Fly     6 FLVIISVCQWLCRFGESRLLEPNCGIRTMPSFHRTRIIGGSDAEITSHPWMAYLYNEFHYFCAGT 70

  Fly    64 LIAYRFVLTAAHCTKINDNLFVRLGEYDSSRTTDGQ-----TRSYRVVSIYRHKNYI-DFRNHDI 122
            ||..:||||||||.:.:.||.||||....:| :||.     ...|.|....:||.:. ....:||
  Fly    71 LITNQFVLTAAHCIEASKNLTVRLGGSGLTR-SDGSMCQITAEDYSVSMAIKHKYFTPSIMLNDI 134

  Fly   123 AVLKLDRQVVYDAYIRPICILLNSGLQSLANSIQNFTLTGWGQMAHYYKMPTTLQEMSLRRVRNE 187
            |:::|.|.|.:..:||||||:|:..::.|.........|||| :|.....|..|||..:..:...
  Fly   135 AMIRLARTVKFYDHIRPICIILDPAVRLLLEDGMTLMATGWG-LADKRMHPHLLQEAPITVMNRN 198

  Fly   188 YC------GVPSLSICCWNPVQYACFGDSGGPLGSLVKYGHKTIYVQFGVTNSVTGNCDGYSSYL 246
            .|      .:....||..:.....|.||||||||.:|.|.....:||:|:|:.....|...|.|.
  Fly   199 VCSKLYDVAITQGQICAGDKETNTCLGDSGGPLGGVVNYYGDLRFVQYGITSFGDIECRSPSIYT 263

  Fly   247 DLMSYMPWL 255
            ||.:|..|:
  Fly   264 DLSTYSGWI 272

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 84/232 (36%)
Tryp_SPc 37..258 CDD:238113 84/234 (36%)
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 85/233 (36%)
Tryp_SPc 42..275 CDD:238113 84/234 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C159549134
eggNOG 1 0.900 E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24260
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.