DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and CG43124

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001247345.1 Gene:CG43124 / 12798282 FlyBaseID:FBgn0262587 Length:245 Species:Drosophila melanogaster


Alignment Length:279 Identity:70/279 - (25%)
Similarity:109/279 - (39%) Gaps:84/279 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LVILTLGSYGYSQLLDSKCIALFRIRVIGGQNARRTPWMAYLIRDNRFACGGSLIAYRFVLTAAH 75
            |.|:.:...|.:|.|:..|:.... |:.|...|   ||:|.::.|::..|.|:||...:|||||.
  Fly     9 LCIVLMFYQGSAQTLEEDCVDHME-RINGSSYA---PWLAEILSDSKVICAGALINNLYVLTAAS 69

  Fly    76 CTKINDNLFVRLGEYDSSRTTDGQTRSYRVVSIYRHKNYIDFRN-HDIAVLKLDRQVVYDAYIRP 139
            |.|.|:.|.||||    |...|....::||...|....:....| :::.:.:|..:|.:..:|||
  Fly    70 CFKENEKLTVRLG----SGYFDKSYENFRVTKAYFWMTHFPANNTNNLCIFRLQTEVEFKTHIRP 130

  Fly   140 ICILLNSGLQSLANSIQNFTLTGWGQMAHYYKMPTTLQEMSLRRVRNEYCGVPSLSICCWNPVQY 204
            :||.                           |.|.:|...:...:.||   .|.:...|.|....
  Fly   131 MCIT---------------------------KSPKSLGLATTFEIINE---KPKMWYFCKNIKGL 165

  Fly   205 AC---FGD------------------SGGPLGSLVKYG------HKTIYVQFGVTNSVTGNCDGY 242
            .|   ||:                  |.||...||:||      :||                 |
  Fly   166 FCKYVFGENEEKWQSKPTGSPWTETISNGPFKGLVRYGILSYRDNKT-----------------Y 213

  Fly   243 SS-YLDLMSYMPWLYQTLL 260
            .. |:::||::.|:.|..|
  Fly   214 DEVYINVMSHINWIAQISL 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 61/246 (25%)
Tryp_SPc 37..258 CDD:238113 61/249 (24%)
CG43124NP_001247345.1 Tryp_SPc 41..>133 CDD:304450 32/95 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.