DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30098 and CG43125

Sequence 1:NP_725573.2 Gene:CG30098 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001247344.1 Gene:CG43125 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster

Alignment Length:287 Identity:67/288 (23%)
Similarity:113/288 (39%) Gaps:80/288 (28%)


  Fly     1 MTPAIVLLTFLVILTLGSYGYSQLLDSKCIALFRIRVIGGQNA--RRTPWMAYLIRD--NRFACG 61
            |:..:.|..|.::|..  .|.:..|:..|          |:::  ...||:..:..:  :...|.
  Fly     1 MSATLRLAVFALLLFY--QGSALFLEQNC----------GKSSVFSPAPWLVKIRPELSSNITCT 53

  Fly    62 GSLIAYRFVLTAAHCTKINDNLFVRLGEYDSSRTTDGQTRSYRVVSIYR---HKNY-IDFRNHDI 122
            |:||..|||||||.|......|.|||||.|.:.....:.: |..:.:.|   |::| .:...::|
  Fly    54 GTLINERFVLTAASCIDYQTELIVRLGEIDGTLQNSSKLQ-YEEIYVARALIHRSYSSESHQYNI 117

  Fly   123 AVLKLDRQVVYDAYIRPICILLNSGLQSLANSIQ---------------------NFTLTGWGQM 166
            |:|:|...|||...|:||||.:|.|....|.:.:                     |:.|:.:|  
  Fly   118 ALLRLKTSVVYKKNIQPICIDVNVGKVPKAPTFEIEKKKNEEPKKNKAGIMKRFLNWFLSLFG-- 180

  Fly   167 AHYYKMPTTLQEMSLRRVRNEYCGVPSLSICCWNPVQYACFGDSGGPLGSLVKYGHKTIYVQFGV 231
                          :|..|.:....|       .|:..      |.||...:  ....::.|:|:
  Fly   181 --------------VREPRPDVILPP-------QPIAV------GWPLTKQI--NESALFHQYGI 216

  Fly   232 ---TNSVTGNCDGYSSYLDLMSYMPWL 255
               .||.:..    ..|.|:|:|:.|:
  Fly   217 LSHRNSESKK----DVYTDVMAYVNWI 239

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 59/250 (24%)
Tryp_SPc 37..258 CDD:238113 60/252 (24%)
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 36/101 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C159547457
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24260
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.