DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30087 and CG4815

DIOPT Version :8

Sequence 1:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster

Alignment Length:243 Identity:60/243 - (24%)
Similarity:103/243 - (42%) Gaps:25/243 - (10%)


  Fly    41 RVVNGKEAVIRSAPFM-VYVTNNSLTHCGGSILNSRYILTAAHCVFPNLRLRLGEHNI---RTDP 101
            |:.||.:..:.|...: :.:.|.....|..::|..|:||||||| |.||. |...|.|   ..:.
  Fly    34 RIYNGIKTTVESLGGVGIQLFNGRKLVCSATLLTPRHILTAAHC-FENLN-RSKFHVIGGKSAEF 96

  Fly   102 DCQGSNCSPRSEEYGIMKAITHRFYNAANHVNDIALLKLNRSINFN-VHIQPIC-ILLNPASAPS 164
            ...|:|.:...    :::...|..|.....:.|:|:.|....:... :....:| .:|:|.....
  Fly    97 TWHGNNFNKNK----LIRVQIHPKYAKMKFIADVAVAKTKYPLRSKYIGYAQLCRSVLHPRDKLI 157

  Fly   165 VATYQTFG--WGETKKNGFPHLLQTAELRAYDAAYCSRSFHAYMNGNQICAG-HEERDTCAGDSG 226
            .|.:...|  |.|::|..|    ::.::.......|.:.....|..|.|||| :..:..|.||||
  Fly   158 AAGWGFEGGVWDESRKKTF----RSMKVGIVSKRDCEKQLDRKMPPNIICAGAYNNKTLCFGDSG 218

  Fly   227 GPLVTRVDFDGVKRYLQLGIVSYGPTDCQSPGVYTYVPNYINWIRRAM 274
            |||:......|:..:      ::...:.:.|.||..|..|..:|:|.:
  Fly   219 GPLLLGRQVCGINTW------TFKCGNNEKPDVYMGVRYYAKFIKRTI 260

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 58/237 (24%)
Tryp_SPc 42..272 CDD:238113 58/238 (24%)
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 55/225 (24%)
Trypsin 49..256 CDD:278516 54/222 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C53391
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24260
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.