DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30087 and CG33465

DIOPT Version :9

Sequence 1:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster

Alignment Length:255 Identity:82/255 - (32%)
Similarity:127/255 - (49%) Gaps:19/255 - (7%)


  Fly    23 AQFLNPLCGVTYESQTAMRVVNGKEAVIRSAPFMVYVTNNSLTHCGGSILNSRYILTAAHCVFPN 87
            ||.|:..|   ::.:|:.. :|.......:||:|..:..|:...|.|::::..::||||.|:..:
  Fly    19 AQLLDKKC---HDPKTSEN-INFNHGATETAPWMASIYKNNQFICDGTLVHKLFVLTAASCISKD 79

  Fly    88 LRLRL--GEHNIRTDPDCQGSNCSPRSEEYGIMKAITHRFYNAANHVNDIALLKLNRSINFNVHI 150
            .:|.:  |.:|...|.....:|     |:||:..|:.|..:...|.||||.||:|...:....||
  Fly    80 SQLYVLFGMYNQYRDASQFFNN-----EQYGVAVALQHSNFRPNNGVNDIGLLRLYGEVTHYAHI 139

  Fly   151 QPICILLNPA--SAPSVATYQTFGWGETKKNGFPHLLQTAELRAYDAAYCSRSFHAY-MNGNQIC 212
            :||||:|:..  ||| ...::.|||.:........:.||..|.......|.|:.... :|..|.|
  Fly   140 RPICIILDHVVKSAP-FERFEGFGWQQQGTEASSQVRQTVYLSQKKPFECHRNGQLLPINEGQFC 203

  Fly   213 AGHEERDTCAGDSGGPLVTRVDFD-GVKRY-LQLGIVSYGPTDCQSPGVYTYVPNYINWI 270
            ||:.:|..|..:||.||.  .||. |||.. :|:|:||||...|....|||.|..:.:||
  Fly   204 AGNRDRSFCRSNSGSPLT--ADFTYGVKNITVQVGLVSYGSELCSPTSVYTDVVAFKDWI 261

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 75/235 (32%)
Tryp_SPc 42..272 CDD:238113 77/236 (33%)
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 75/224 (33%)
Tryp_SPc 46..261 CDD:214473 73/222 (33%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463425
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.