DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30087 and CG33465

DIOPT Version :8

Sequence 1:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster

Alignment Length:255 Identity:82/255 - (32%)
Similarity:127/255 - (49%) Gaps:19/255 - (7%)


  Fly    23 AQFLNPLCGVTYESQTAMRVVNGKEAVIRSAPFMVYVTNNSLTHCGGSILNSRYILTAAHCVFPN 87
            ||.|:..|   ::.:|:.. :|.......:||:|..:..|:...|.|::::..::||||.|:..:
  Fly    19 AQLLDKKC---HDPKTSEN-INFNHGATETAPWMASIYKNNQFICDGTLVHKLFVLTAASCISKD 79

  Fly    88 LRLRL--GEHNIRTDPDCQGSNCSPRSEEYGIMKAITHRFYNAANHVNDIALLKLNRSINFNVHI 150
            .:|.:  |.:|...|.....:|     |:||:..|:.|..:...|.||||.||:|...:....||
  Fly    80 SQLYVLFGMYNQYRDASQFFNN-----EQYGVAVALQHSNFRPNNGVNDIGLLRLYGEVTHYAHI 139

  Fly   151 QPICILLNPA--SAPSVATYQTFGWGETKKNGFPHLLQTAELRAYDAAYCSRSFHAY-MNGNQIC 212
            :||||:|:..  ||| ...::.|||.:........:.||..|.......|.|:.... :|..|.|
  Fly   140 RPICIILDHVVKSAP-FERFEGFGWQQQGTEASSQVRQTVYLSQKKPFECHRNGQLLPINEGQFC 203

  Fly   213 AGHEERDTCAGDSGGPLVTRVDFD-GVKRY-LQLGIVSYGPTDCQSPGVYTYVPNYINWI 270
            ||:.:|..|..:||.||.  .||. |||.. :|:|:||||...|....|||.|..:.:||
  Fly   204 AGNRDRSFCRSNSGSPLT--ADFTYGVKNITVQVGLVSYGSELCSPTSVYTDVVAFKDWI 261

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 75/235 (32%)
Tryp_SPc 42..272 CDD:238113 77/236 (33%)
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 75/224 (33%)
Tryp_SPc 46..261 CDD:214473 73/222 (33%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C159547638
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3442
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24260
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.080

Return to query results.
Submit another query.