DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30087 and Jon65Aii

DIOPT Version :9

Sequence 1:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster


Alignment Length:287 Identity:80/287 - (27%)
Similarity:117/287 - (40%) Gaps:69/287 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FVIAICLIRQQRIVDAQFLNPLCGVTYESQTAMRVVNGKEAVIRSAPFMVYVT----NNSLTHCG 68
            |.:...|.|...:.|....|.:.|         |:.||..|.....|::|.:.    |....:||
  Fly    12 FALVAALERPVPVKDMPAGNKING---------RITNGYPAYEGKVPYIVALRFDNGNGGGWYCG 67

  Fly    69 GSILNSRYILTAAHCVFPNLRLRLGEHNIRTDPDCQGSNCSPRSEEYGIM----KAITHRFYNAA 129
            |||:...::||||||.:                     ..|..:..||.:    ...||  |:..
  Fly    68 GSIIGHEWVLTAAHCTY---------------------GASYVTISYGAVWRQQPQFTH--YDTG 109

  Fly   130 NHVNDIALLKLNRSINFNVHIQPICILLNPASAPSV-ATYQTF--------GWGETK-KNGFPHL 184
            |..|||||::       ..|:. ...|:|....|.. ..|..|        |||.:. .:|....
  Fly   110 NLHNDIALIR-------TPHVD-FWSLVNKVELPRYDDRYNNFYGWWALLSGWGSSSDSSGMTDY 166

  Fly   185 LQTAELRAYDAAYCSRSFHA-YMNGNQIC-AGHEERDTCAGDSGGPLVTRVDFDGVKRYLQLGIV 247
            |...:::..|.:.|...:.: |:..|.:| |..|.:.:|:||||||||..   ||.:   |:|||
  Fly   167 LNCVDIQISDNSVCLDYYGSHYITSNHLCYATPENKGSCSGDSGGPLVLH---DGNR---QVGIV 225

  Fly   248 SYG-PTDC--QSPGVYTYVPNYINWIR 271
            |:| ...|  .||...|.|..|::|||
  Fly   226 SFGSAAGCLSNSPKGLTRVTGYLDWIR 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 71/251 (28%)
Tryp_SPc 42..272 CDD:238113 73/253 (29%)
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 71/251 (28%)
Tryp_SPc 37..254 CDD:238113 73/253 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435644
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.