DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30087 and CG30283

DIOPT Version :8

Sequence 1:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster

Alignment Length:282 Identity:88/282 - (31%)
Similarity:145/282 - (51%) Gaps:28/282 - (9%)


  Fly     8 FVIAICLIRQQRIV----DAQFLNPLCGVTYESQTAMRVVNGKEAVIRSAPFMVYVTNNSLTHCG 68
            ||:.:.|.....:|    ...||...||....||  .:::.|..|.:.|||:|..|......|||
  Fly     7 FVVVVLLAASSVVVLGSESGSFLEHPCGTVPISQ--FKILGGHNAPVASAPWMAMVMGEGGFHCG 69

  Fly    69 GSILNSRYILTAAHCVF-PNLRLRLGEHNIRTDPDCQGSNCSPRSEEYGIMKAITHRFYNAANHV 132
            |:::.:|::||:|||:. ..|::|||.  :..:.:.|         ::.:.....|..|....| 
  Fly    70 GTLITNRFVLTSAHCIANGELKVRLGV--LEREAEAQ---------KFAVDAMFVHTDYYFDQH- 122

  Fly   133 NDIALLKLNRSINFNVHIQPICILLNPASA---PSVATYQTFGWGETKKNGFPHLLQTAELRAYD 194
             |:|||:|.:.::::.:|.|||:||:|...   ..:..::|:|||:|:......:||...|....
  Fly   123 -DLALLRLAKRVHYSDNISPICLLLDPLVKNIDEHIVKFRTYGWGKTESRSSSRMLQKTSLFNLH 186

  Fly   195 AAYCSRSF-HAYMNGNQICAGHEERDTCAGDSGGPLVTRVDFDGVKRYLQLGIVSYGPTDCQSPG 258
            .:.|::.: |..:|.|.|||.....:||.|||||||...|.:|.|:...|.|:.|:|..||....
  Fly   187 RSECAKQYPHQQINRNHICAESANANTCNGDSGGPLTAIVTYDHVQMVFQFGVTSFGHADCSKAT 251

  Fly   259 VYTYVPNYINWI----RRAMLI 276
            |:|.|..:::||    |||.::
  Fly   252 VFTNVMTHLDWIVNTVRRAEIM 273

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 73/233 (31%)
Tryp_SPc 42..272 CDD:238113 75/238 (32%)
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 73/233 (31%)
Tryp_SPc 43..266 CDD:238113 75/235 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3442
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24260
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.150

Return to query results.
Submit another query.