DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30087 and CG10764

DIOPT Version :8

Sequence 1:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster

Alignment Length:276 Identity:97/276 - (35%)
Similarity:152/276 - (55%) Gaps:27/276 - (9%)


  Fly     9 VIAICLIRQQRIVDAQFLNPLCGVTYESQTAMRVVNGKEAVIRSAPFMVYVTNNSLTHCGGSILN 73
            ::.:|:...:..   :||...||::    |..::..|.:|...::.:|..:.|:|...|||:|::
  Fly    12 LLTLCVTENEHF---KFLETPCGIS----TRPKISGGDDAAEPNSIWMAAIFNSSDFQCGGTIIH 69

  Fly    74 SRYILTAAHCVFP--NLRLRLGEHNIRTDPDCQGSNCSPRSEEYGIMKAITHRFYNAANHVNDIA 136
            .|::|:||||:..  :|.:|||..|| .:|          :..:.::....|..:.|:.:.|||.
  Fly    70 MRFVLSAAHCLVRGYDLYVRLGARNI-NEP----------AAVHTVINVFVHHDFIASEYRNDIG 123

  Fly   137 LLKLNRSINFNVHIQPICILLNPA---SAPSVATYQTFGWGETKKNG-FPHLLQTAELRAYDAAY 197
            ||:|:.||.:.|.:|||||.|:||   |...:.|::..|||  .:|| ...:|||..|.......
  Fly   124 LLQLSESIVYTVRVQPICIFLDPALKGSVEKLKTFRALGWG--NRNGKLSIMLQTIYLLHLKRNE 186

  Fly   198 CSRSFHAYMNGNQICAGHEERDTCAGDSGGPLVTRVDFDGVKRY-LQLGIVSYGPTDCQSPGVYT 261
            |.|..:..:|..|||||.:..|||.|||||||.|.:.|...|.| :||||||:|..:|:..||||
  Fly   187 CKRKLNFNLNSRQICAGTKNGDTCRGDSGGPLSTNILFPSNKSYEVQLGIVSFGDPECRGVGVYT 251

  Fly   262 YVPNYINWIRRAMLIN 277
            .|.:|::||...:..|
  Fly   252 DVTSYVDWISSTIARN 267

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 88/235 (37%)
Tryp_SPc 42..272 CDD:238113 90/236 (38%)
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 88/235 (37%)
Tryp_SPc 38..263 CDD:238113 90/237 (38%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C159547898
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_133884
Panther 1 1.100 P PTHR24260
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.