DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30087 and CG10764

DIOPT Version :9

Sequence 1:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster


Alignment Length:276 Identity:97/276 - (35%)
Similarity:152/276 - (55%) Gaps:27/276 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VIAICLIRQQRIVDAQFLNPLCGVTYESQTAMRVVNGKEAVIRSAPFMVYVTNNSLTHCGGSILN 73
            ::.:|:...:..   :||...||::    |..::..|.:|...::.:|..:.|:|...|||:|::
  Fly    12 LLTLCVTENEHF---KFLETPCGIS----TRPKISGGDDAAEPNSIWMAAIFNSSDFQCGGTIIH 69

  Fly    74 SRYILTAAHCVFP--NLRLRLGEHNIRTDPDCQGSNCSPRSEEYGIMKAITHRFYNAANHVNDIA 136
            .|::|:||||:..  :|.:|||..|| .:|          :..:.::....|..:.|:.:.|||.
  Fly    70 MRFVLSAAHCLVRGYDLYVRLGARNI-NEP----------AAVHTVINVFVHHDFIASEYRNDIG 123

  Fly   137 LLKLNRSINFNVHIQPICILLNPA---SAPSVATYQTFGWGETKKNG-FPHLLQTAELRAYDAAY 197
            ||:|:.||.:.|.:|||||.|:||   |...:.|::..|||  .:|| ...:|||..|.......
  Fly   124 LLQLSESIVYTVRVQPICIFLDPALKGSVEKLKTFRALGWG--NRNGKLSIMLQTIYLLHLKRNE 186

  Fly   198 CSRSFHAYMNGNQICAGHEERDTCAGDSGGPLVTRVDFDGVKRY-LQLGIVSYGPTDCQSPGVYT 261
            |.|..:..:|..|||||.:..|||.|||||||.|.:.|...|.| :||||||:|..:|:..||||
  Fly   187 CKRKLNFNLNSRQICAGTKNGDTCRGDSGGPLSTNILFPSNKSYEVQLGIVSFGDPECRGVGVYT 251

  Fly   262 YVPNYINWIRRAMLIN 277
            .|.:|::||...:..|
  Fly   252 DVTSYVDWISSTIARN 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 88/235 (37%)
Tryp_SPc 42..272 CDD:238113 90/236 (38%)
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 88/235 (37%)
Tryp_SPc 38..263 CDD:238113 90/237 (38%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463421
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4848
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
76.990

Return to query results.
Submit another query.