DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30087 and CG31205

DIOPT Version :8

Sequence 1:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster

Alignment Length:306 Identity:68/306 - (22%)
Similarity:119/306 - (38%) Gaps:87/306 - (28%)


  Fly     8 FVIAICLIRQQRIVDAQFLNPLCGVTYESQTAMRVVNGKEAVIRSA--PFMVYVT------NNSL 64
            |::.|..:..  .:.|..:...||:..|.|     .|....:....  |::|.:.      :|:|
  Fly     9 FLLTITTLHP--TIQAASVGQECGIFNEKQ-----YNSDNIIAEPTEHPWVVRIVGVTKDGSNTL 66

  Fly    65 THCGGSILNSRYILTAAHCVFPNLRLRLGEHN-----IRTDPDCQGSNCSPRSEEYGIMKAIT-H 123
            . |.|.:::||.::||||||..:      |..     :..|.|         |....::.|:| |
  Fly    67 L-CTGILIDSRRVVTAAHCVSKD------ESESIYGVVFGDSD---------SSNINLVSAVTVH 115

  Fly   124 RFYNAANHVNDIALLKLNRSINFNVHIQPICILLNPASAPSVATYQTFGWGETKKNGFPHLLQTA 188
            ..|:.....||:|:::|.:.:.|:..:||||:       |||:  :.....||..:..  ::...
  Fly   116 PDYSPRKFENDLAIIELTKEVVFSDLVQPICL-------PSVS--EMVPGSETSNSKL--IVAGL 169

  Fly   189 ELRAYDAAYC-----------------SRSFH---AYMNGNQICAGHEERDTCAGD-----SGGP 228
            |..::|..:.                 |:..|   |......|| ||.||...:|.     ||.|
  Fly   170 EGPSFDRRHSATQRLDKRIKMTYTKIDSKECHEKQARFPEELIC-GHTERSPLSGSALTEASGTP 233

  Fly   229 LVTRVDFDGVKRYLQLGIVSYG--PTDCQSPGVYTYVPNYINWIRR 272
                      :::..|||...|  .:|....| |..:..:::||.:
  Fly   234 ----------RQFHLLGIAVAGFFSSDLDHQG-YLNIRPHLDWISK 268

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 59/269 (22%)
Tryp_SPc 42..272 CDD:238113 61/270 (23%)
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 36/150 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24260
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.