| Sequence 1: | NP_725489.2 | Gene: | CG30087 / 246446 | FlyBaseID: | FBgn0050087 | Length: | 277 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001287432.1 | Gene: | CG31205 / 318626 | FlyBaseID: | FBgn0051205 | Length: | 274 | Species: | Drosophila melanogaster | 
| Alignment Length: | 306 | Identity: | 68/306 - (22%) | 
|---|---|---|---|
| Similarity: | 119/306 - (38%) | Gaps: | 87/306 - (28%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly     8 FVIAICLIRQQRIVDAQFLNPLCGVTYESQTAMRVVNGKEAVIRSA--PFMVYVT------NNSL 64 
  Fly    65 THCGGSILNSRYILTAAHCVFPNLRLRLGEHN-----IRTDPDCQGSNCSPRSEEYGIMKAIT-H 123 
  Fly   124 RFYNAANHVNDIALLKLNRSINFNVHIQPICILLNPASAPSVATYQTFGWGETKKNGFPHLLQTA 188 
  Fly   189 ELRAYDAAYC-----------------SRSFH---AYMNGNQICAGHEERDTCAGD-----SGGP 228 
  Fly   229 LVTRVDFDGVKRYLQLGIVSYG--PTDCQSPGVYTYVPNYINWIRR 272 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG30087 | NP_725489.2 | Tryp_SPc | 41..270 | CDD:214473 | 59/269 (22%) | 
| Tryp_SPc | 42..272 | CDD:238113 | 61/270 (23%) | ||
| CG31205 | NP_001287432.1 | Tryp_SPc | 44..>168 | CDD:304450 | 36/150 (24%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR24260 | 
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 2.010 | |||||