powered by:
Protein Alignment CG30087 and T22A3.6
DIOPT Version :8
Sequence 1: | NP_725489.2 |
Gene: | CG30087 / 246446 |
FlyBaseID: | FBgn0050087 |
Length: | 277 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_492773.3 |
Gene: | T22A3.6 / 188711 |
WormBaseID: | WBGene00011909 |
Length: | 491 |
Species: | Caenorhabditis elegans |
Alignment Length: | 67 |
Identity: | 17/67 - (25%) |
Similarity: | 25/67 - (37%) |
Gaps: | 20/67 - (29%) |
Fly 152 PICILLNPASA-------PSVATYQTFGWGETKKNGFPH-------LLQTAEL----RAYDAAYC 198
|.|.:.|..:| ||..|...|.. ..::|||: :|...:| :..|..|.
Worm 156 PWCYVGNDTTAPCFQPCRPSTETSSDFVC--LNRDGFPYTDYDMSDILDLPQLIGIFKDVDLMYE 218
Fly 199 SR 200
||
Worm 219 SR 220
|
Known Domains:
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
|
|
O |
PTHR24260 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.