DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30087 and CG42694

DIOPT Version :8

Sequence 1:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster

Alignment Length:289 Identity:74/289 - (25%)
Similarity:122/289 - (42%) Gaps:55/289 - (19%)


  Fly     1 MKTSPAWFVIAICLIRQQRIVDAQFLNPLCGVTYESQTAMRVVNGKEAVIRSAPFMVYVTNNSLT 65
            |:|..||.::...|   |..|:::||:..||....:|:..::...:      |.::.:::|.:..
  Fly     1 MQTLFAWLLMLTVL---QSHVNSKFLDDYCGAPISNQSITKLRQPQ------AGWLAHISNGTHV 56

  Fly    66 HCGGSILNSRYILTAAHC--VFPNLRLRLGEHNIRTDPDCQGSNCSPRSEEYGIMKAITHRFYNA 128
            .|.||:::.:::|:||.|  |...|.::||..|....|                      .:|..
  Fly    57 LCSGSLISKQFVLSAAQCIDVHGKLFVQLGVSNATKSP----------------------HWYTV 99

  Fly   129 ANHV----------NDIALLKLNRSINFNVHIQPICILLNPASAPSVATYQTF---GWGETKKNG 180
            :|.|          .||.||||::|:::|..:.||||.||..:...|...|.|   .|....||.
  Fly   100 SNVVIPSHSGKRLQRDIGLLKLSQSVDYNDFVYPICIALNTNTLDMVKILQNFTTSAWLSKNKNP 164

  Fly   181 FPHLLQTAELRAYDAAYCSRSFHAYMNGNQICAGHEER-DTCAGDSGGPLVTR-VDFDGVKRYLQ 243
                 ||..|.......|..:....:...:|||...:| ::|..|||..|... :....:.|.:.
  Fly   165 -----QTIVLSQLSRDRCKLNLSGNVTPKEICAASLQRNNSCFIDSGSALTQPIIQGSNIVREML 224

  Fly   244 LGIVSY--GPTDCQSPGVYTYVPNYINWI 270
            .||..|  |.:.|..|.:|..|...:.||
  Fly   225 FGIRGYVNGRSWCSEPAIYIDVAECVGWI 253

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 60/247 (24%)
Tryp_SPc 42..272 CDD:238113 62/248 (25%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450 61/235 (26%)
Tryp_SPc 46..253 CDD:214473 59/233 (25%)
Tryp_SPc 319..505 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C159547710
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24260
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.