DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30087 and CG42694

DIOPT Version :9

Sequence 1:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:289 Identity:74/289 - (25%)
Similarity:122/289 - (42%) Gaps:55/289 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKTSPAWFVIAICLIRQQRIVDAQFLNPLCGVTYESQTAMRVVNGKEAVIRSAPFMVYVTNNSLT 65
            |:|..||.::...|   |..|:::||:..||....:|:..::...:      |.::.:::|.:..
  Fly     1 MQTLFAWLLMLTVL---QSHVNSKFLDDYCGAPISNQSITKLRQPQ------AGWLAHISNGTHV 56

  Fly    66 HCGGSILNSRYILTAAHC--VFPNLRLRLGEHNIRTDPDCQGSNCSPRSEEYGIMKAITHRFYNA 128
            .|.||:::.:::|:||.|  |...|.::||..|....|                      .:|..
  Fly    57 LCSGSLISKQFVLSAAQCIDVHGKLFVQLGVSNATKSP----------------------HWYTV 99

  Fly   129 ANHV----------NDIALLKLNRSINFNVHIQPICILLNPASAPSVATYQTF---GWGETKKNG 180
            :|.|          .||.||||::|:::|..:.||||.||..:...|...|.|   .|....||.
  Fly   100 SNVVIPSHSGKRLQRDIGLLKLSQSVDYNDFVYPICIALNTNTLDMVKILQNFTTSAWLSKNKNP 164

  Fly   181 FPHLLQTAELRAYDAAYCSRSFHAYMNGNQICAGHEER-DTCAGDSGGPLVTR-VDFDGVKRYLQ 243
                 ||..|.......|..:....:...:|||...:| ::|..|||..|... :....:.|.:.
  Fly   165 -----QTIVLSQLSRDRCKLNLSGNVTPKEICAASLQRNNSCFIDSGSALTQPIIQGSNIVREML 224

  Fly   244 LGIVSY--GPTDCQSPGVYTYVPNYINWI 270
            .||..|  |.:.|..|.:|..|...:.||
  Fly   225 FGIRGYVNGRSWCSEPAIYIDVAECVGWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 60/247 (24%)
Tryp_SPc 42..272 CDD:238113 62/248 (25%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450 61/235 (26%)
Tryp_SPc 46..253 CDD:214473 59/233 (25%)
Tryp_SPc 319..505 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463426
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4848
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.