DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Blos1 and BLOS1

Sequence 1:NP_725401.2 Gene:Blos1 FlyBaseID:FBgn0050077 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_180592.1 Gene:BLOS1 AraportID:AT2G30330 Length:152 Species:Arabidopsis thaliana

Alignment Length:111 Identity:34/112 (30%)
Similarity:64/112 (57%) Gaps:0/112 (0%)


  Fly     2 LTSMVKEHHKEQAKRKQEQEVRRKEAIEASNELTQSLVDTLNVGVAQAYLNQKRLDAEAKQLHLG 66
            |..::.::.:...:.:::.|..|||||..:......||..:|.||.:.::|:||:::|.:.|.:.
plant    34 LLQLIDDNRRSSLQLREKTERSRKEAIRHAARTADLLVKAVNGGVEECFVNEKRIESEIRNLAIT 98

  Fly    67 ATNFAKQTHQWLQLIDQFSTALKDLGDVENWARSIEGDMHTINQTL 112
            ...|.|||.|||.:....::|:|::||.|||.:::|.|...|...:
plant    99 VAKFGKQTDQWLAVTHAVNSAVKEIGDFENWMKTMEFDCKKITAAI 144

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Blos1NP_725401.2 GCN5L1 5..117 CDD:283881 33/109 (30%)
BLOS1NP_180592.1 GCN5L1 37..149 CDD:283881 33/109 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2335
OMA 1 1.010
OrthoDB 1 1.010 D1603359at2759
OrthoInspector 1 1.000 T193080
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR13073
Phylome 1 0.910 0.667 Consistency score
77.080

Return to query results.
Submit another query.