DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Blos1 and bloc1s1

Sequence 1:NP_725401.2 Gene:Blos1 FlyBaseID:FBgn0050077 Length:147 Species:Drosophila melanogaster
Sequence 2:XP_012812677.1 Gene:bloc1s1 XenbaseID:XB-GENE-952074 Length:145 Species:Xenopus tropicalis

Alignment Length:109 Identity:61/110 (55%)
Similarity:79/110 (72%) Gaps:2/110 (2%)


  Fly     9 HHKEQAKRKQEQEVRRKEAIEASNELTQSLVDTLNVGVAQAYLNQKRLDAEAKQLHLGATNFAKQ 73
            |.:.:.:.|:|:  |||:||.|:..||::|||.|||||||||:||::||.|.|.|...|..||||
 Frog    31 HTRTEYRTKREK--RRKDAIAAATTLTEALVDHLNVGVAQAYVNQRKLDHEVKTLQTQAAQFAKQ 93

  Fly    74 THQWLQLIDQFSTALKDLGDVENWARSIEGDMHTINQTLELAYK 117
            |.||:.|::.|:.|||::|||||||||||.||..|...||..||
 Frog    94 TTQWISLVENFNQALKEIGDVENWARSIEKDMRIIATALEYVYK 137

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Blos1NP_725401.2 GCN5L1 5..117 CDD:283881 60/108 (56%)
bloc1s1XP_012812677.1 GCN5L1 31..137 CDD:283881 60/108 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C209412767
eggNOG 1 0.900 E1_KOG3390
Hieranoid 1 1.000
Homologene 1 1.000 H1140
Inparanoid 1 1.050 139 1.000 Inparanoid score I4282
OMA 1 1.010
OrthoDB 1 1.010 D1603359at2759
OrthoFinder 1 1.000 FOG0006110
OrthoInspector 1 1.000 T1058332
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2425
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.