DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Blos1 and bloc1s1

Sequence 1:NP_725401.2 Gene:Blos1 FlyBaseID:FBgn0050077 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_001037815.1 Gene:bloc1s1 ZFINID:ZDB-GENE-050208-569 Length:125 Species:Danio rerio

Alignment Length:117 Identity:67/118 (57%)
Similarity:89/118 (75%) Gaps:0/118 (0%)


  Fly     1 MLTSMVKEHHKEQAKRKQEQEVRRKEAIEASNELTQSLVDTLNVGVAQAYLNQKRLDAEAKQLHL 65
            ||:.::|||..:|.:||:.||.||:|||.|:..||::|||.|||||||||:||::||.|.|.|.:
Zfish     1 MLSRLLKEHQAKQNERKELQERRRREAIAAATCLTEALVDHLNVGVAQAYVNQRKLDHEVKTLQV 65

  Fly    66 GATNFAKQTHQWLQLIDQFSTALKDLGDVENWARSIEGDMHTINQTLELAYK 117
            .|..|||||.||:.:::.|:.|||::|||||||||||.||.||...||..:|
Zfish    66 QAGQFAKQTAQWINMVENFNQALKEIGDVENWARSIEMDMRTIATALEYVHK 117

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Blos1NP_725401.2 GCN5L1 5..117 CDD:283881 64/112 (57%)
bloc1s1NP_001037815.1 GCN5L1 5..117 CDD:283881 64/112 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C209414236
eggNOG 1 0.900 E1_KOG3390
Hieranoid 1 1.000
Homologene 1 1.000 H1140
Inparanoid 1 1.050 136 1.000 Inparanoid score I4471
OMA 1 1.010
OrthoDB 1 1.010 D1603359at2759
OrthoFinder 1 1.000 FOG0006110
OrthoInspector 1 1.000 T1051690
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR13073
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2425
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1312.900

Return to query results.
Submit another query.