DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Blos1 and BLOC1S1

DIOPT Version :10

Sequence 1:NP_725401.2 Gene:Blos1 / 246439 FlyBaseID:FBgn0050077 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_001478.2 Gene:BLOC1S1 / 2647 HGNCID:4200 Length:153 Species:Homo sapiens


Alignment Length:117 Identity:68/117 - (58%)
Similarity:89/117 - (76%) Gaps:0/117 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLTSMVKEHHKEQAKRKQEQEVRRKEAIEASNELTQSLVDTLNVGVAQAYLNQKRLDAEAKQLHL 65
            ||:.::|||..:|.:||:.||.||:|||.|:..||::|||.|||||||||:||::||.|.|.|.:
Human    29 MLSRLLKEHQAKQNERKELQEKRRREAITAATCLTEALVDHLNVGVAQAYMNQRKLDHEVKTLQV 93

  Fly    66 GATNFAKQTHQWLQLIDQFSTALKDLGDVENWARSIEGDMHTINQTLELAYK 117
            .|..|||||.||:.:::.|:.|||::|||||||||||.||.||...||..||
Human    94 QAAQFAKQTGQWIGMVENFNQALKEIGDVENWARSIELDMRTIATALEYVYK 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Blos1NP_725401.2 GCN5L1 5..117 CDD:461876 64/111 (58%)
BLOC1S1NP_001478.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
GCN5L1 33..145 CDD:461876 64/111 (58%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.