DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Blos1 and blos-1

Sequence 1:NP_725401.2 Gene:Blos1 FlyBaseID:FBgn0050077 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_499262.2 Gene:blos-1 WormBaseID:WBGene00011872 Length:135 Species:Caenorhabditis elegans

Alignment Length:117 Identity:59/118 (50%)
Similarity:82/118 (69%) Gaps:0/118 (0%)


  Fly     2 LTSMVKEHHKEQAKRKQEQEVRRKEAIEASNELTQSLVDTLNVGVAQAYLNQKRLDAEAKQLHLG 66
            |::|:|||.|:|..|::.||..:.|||.|:..|:.::||.||..|||||.||||||.|||:....
 Worm     4 LSNMLKEHSKKQHLRREVQEKLKNEAIVAAQTLSTAVVDHLNAKVAQAYGNQKRLDVEAKRFENN 68

  Fly    67 ATNFAKQTHQWLQLIDQFSTALKDLGDVENWARSIEGDMHTINQTLELAYKA 118
            :...||||.|||.:.:..:.|||::||||||:::||.||..|.:||..||:|
 Worm    69 SAALAKQTEQWLFITEGLNYALKEIGDVENWSKTIENDMKIITETLRRAYEA 120

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Blos1NP_725401.2 GCN5L1 5..117 CDD:283881 57/112 (51%)
blos-1NP_499262.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C209407823
eggNOG 1 0.900 E1_KOG3390
Hieranoid 1 1.000
Homologene 1 1.000 H1140
Inparanoid 1 1.050 115 1.000 Inparanoid score I3356
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1603359at2759
OrthoFinder 1 1.000 FOG0006110
OrthoInspector 1 1.000 T477202
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR13073
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2425
TreeFam 1 0.960
1312.900

Return to query results.
Submit another query.