DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30062 and LysE

DIOPT Version :8

Sequence 1:NP_725299.2 Gene:CG30062 / 246428 FlyBaseID:FBgn0050062 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_476827.2 Gene:LysE / 38128 FlyBaseID:FBgn0004428 Length:140 Species:Drosophila melanogaster

Alignment Length:129 Identity:62/130 (48%)
Similarity:88/130 (68%) Gaps:3/130 (2%)


  Fly    23 PLLAIRLQPCELAGQLYILDVPKSELPLWLCIAEFESRFNTHVVGQANADGSRDYGLFQISDRYW 87
            |.|...|..|.||.::..|.||:.:|..|.||||.||.:.|.|||..|.:||.|||:|||::.||
  Fly    15 PALGRTLDRCSLAREMSNLGVPRDQLARWACIAEHESSYRTGVVGPENYNGSNDYGIFQINNYYW 79

  Fly    88 CAPPNRTEYYAFNDCNVNCTHLLSDDITMAVQCARLIQKQQGWTAWSVYPEFCNGTLDAIDVCF 151
            ||||:..  :::|:|.::|..||:||||.:|:||:.:..||||:|||.: .:|:|.|.:||.||
  Fly    80 CAPPSGR--FSYNECGLSCNALLTDDITHSVRCAQKVLSQQGWSAWSTW-HYCSGWLPSIDGCF 140

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30062NP_725299.2 lysozyme_like 32..150 CDD:294153 57/118 (48%)
LysENP_476827.2 Lys 19..139 CDD:278491 58/123 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130907451
eggNOG 1 0.900 E1_2BPI7
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4801
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1551203at2759
OrthoFinder 1 1.000 FOG0000203
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11407
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.