DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30062 and Lyzl6

DIOPT Version :8

Sequence 1:NP_725299.2 Gene:CG30062 / 246428 FlyBaseID:FBgn0050062 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_001129305.2 Gene:Lyzl6 / 287751 RGDID:1306968 Length:149 Species:Rattus norvegicus

Alignment Length:118 Identity:46/119 (39%)
Similarity:67/119 (56%) Gaps:14/119 (12%)


  Fly    32 CELAGQLYILDVPKSE---LPLWLCIAEFESRFNTHVVGQANADGSRDYGLFQISDRYWCAPPNR 93
            |.||..||..|:...|   ||.|||:|..||:||...|.: ||||:.|||:|||:.||||   |.
  Rat    26 CTLARILYQEDLDGFEGYSLPHWLCLAFVESKFNISKVTE-NADGTFDYGIFQINSRYWC---ND 86

  Fly    94 TEYYAFNDCNVNCTHLLSDDITMAVQCARLIQKQQG----WTAWSVYPEFCNG 142
            .:.::.|.|.::|..||:.::..::.||::|....|    |..|.::   |.|
  Rat    87 YQSHSENFCRLDCEELLNPNLIPSIHCAKMIVSGSGGMKNWVDWRLH---CLG 136

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30062NP_725299.2 lysozyme_like 32..150 CDD:294153 46/119 (39%)
Lyzl6NP_001129305.2 LYZ1 22..143 CDD:238066 46/119 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48474285
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1551203at2759
OrthoFinder 1 1.000 FOG0000203
OrthoInspector 1 1.000 T131092
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11407
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.040

Return to query results.
Submit another query.