DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30062 and Spaca3

DIOPT Version :8

Sequence 1:NP_725299.2 Gene:CG30062 / 246428 FlyBaseID:FBgn0050062 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_001099290.1 Gene:Spaca3 / 287557 RGDID:1306684 Length:163 Species:Rattus norvegicus

Alignment Length:127 Identity:47/127 - (37%)
Similarity:63/127 - (49%) Gaps:14/127 - (11%)


  Fly    32 CELAGQLYILDVP---KSELPLWLCIAEFESRFNTHVVGQANADGSRDYGLFQISDRYWC--APP 91
            ||||..|:...:.   ...|..|:|:|.:.|.|||..|.. .||||.:.|:||||.|.||  ..|
  Rat    41 CELAKVLHDFGLEGYRGYNLADWICLAYYTSGFNTDAVDH-EADGSTNNGIFQISSRKWCKNLAP 104

  Fly    92 NRTEYYAFNDCNVNCTHLLSDDITMAVQCA-RLIQKQQGWTAWSVYPEFCNG--TLDAIDVC 150
            |..     |.|.:.||.|||:|:..:|.|. ::.|:.||...|..:...|.|  ..|.:|.|
  Rat   105 NGP-----NLCRIYCTDLLSNDLKDSVACVMKIAQEPQGLGYWESWKHHCQGRDLSDWVDGC 161

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30062NP_725299.2 lysozyme_like 32..150 CDD:294153 46/125 (37%)
Spaca3NP_001099290.1 LYZ1 36..159 CDD:238066 45/123 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48319857
eggNOG 1 0.900 E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1551203at2759
OrthoFinder 1 1.000 FOG0000203
OrthoInspector 1 1.000 T131092
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11407
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.