DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30062 and Spaca3

DIOPT Version :9

Sequence 1:NP_725299.2 Gene:CG30062 / 246428 FlyBaseID:FBgn0050062 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_001099290.1 Gene:Spaca3 / 287557 RGDID:1306684 Length:163 Species:Rattus norvegicus


Alignment Length:127 Identity:47/127 - (37%)
Similarity:63/127 - (49%) Gaps:14/127 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 CELAGQLYILDVP---KSELPLWLCIAEFESRFNTHVVGQANADGSRDYGLFQISDRYWC--APP 91
            ||||..|:...:.   ...|..|:|:|.:.|.|||..|.. .||||.:.|:||||.|.||  ..|
  Rat    41 CELAKVLHDFGLEGYRGYNLADWICLAYYTSGFNTDAVDH-EADGSTNNGIFQISSRKWCKNLAP 104

  Fly    92 NRTEYYAFNDCNVNCTHLLSDDITMAVQCA-RLIQKQQGWTAWSVYPEFCNG--TLDAIDVC 150
            |..     |.|.:.||.|||:|:..:|.|. ::.|:.||...|..:...|.|  ..|.:|.|
  Rat   105 NGP-----NLCRIYCTDLLSNDLKDSVACVMKIAQEPQGLGYWESWKHHCQGRDLSDWVDGC 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30062NP_725299.2 lysozyme_like 32..150 CDD:294153 46/125 (37%)
Spaca3NP_001099290.1 LYZ_C 36..161 CDD:340383 46/125 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347573
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8912
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.