DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30062 and Lyz2

DIOPT Version :9

Sequence 1:NP_725299.2 Gene:CG30062 / 246428 FlyBaseID:FBgn0050062 Length:171 Species:Drosophila melanogaster
Sequence 2:XP_038934368.1 Gene:Lyz2 / 25211 RGDID:3026 Length:192 Species:Rattus norvegicus


Alignment Length:185 Identity:51/185 - (27%)
Similarity:69/185 - (37%) Gaps:60/185 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VRVLPLLWFLFHGIPLLAIRLQPCELAGQL--------YILDVPKSELPLWLCIAEFESRFNTHV 65
            ::.|.:|.||.....:.|...:.||.|..|        |.:     .|..|:|:|:.||.:||..
  Rat     1 MKALLVLGFLLLSASVQAKTYERCEFARTLKRNGMSGYYGV-----SLADWVCLAQHESNYNTQA 60

  Fly    66 VGQANADGSRDYGLFQISDRYWCAPPNRTEYYAFNDCNVNC------------------------ 106
            ......|.|.|||:|||:.||||.......  |.|.|.:.|                        
  Rat    61 RNYNPGDQSTDYGIFQINSRYWCNDGKTPR--AKNACGIPCSAVVTEKSSKHQQRRDILSLGTAS 123

  Fly   107 --------------------THLLSDDITMAVQCA-RLIQKQQGWTAWSVYPEFC 140
                                |.||.||||.|:||| |:::..||..||..:...|
  Rat   124 IHLSGSLWETLLRNVNPAVHTSLLQDDITQAIQCAKRVVRDPQGIRAWVAWQRHC 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30062NP_725299.2 lysozyme_like 32..150 CDD:294153 46/162 (28%)
Lyz2XP_038934368.1 LYZ1 19..191 CDD:197612 46/167 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347549
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 109 1.000 Inparanoid score I4799
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8912
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X173
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.