DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30062 and Lyz2

DIOPT Version :8

Sequence 1:NP_725299.2 Gene:CG30062 / 246428 FlyBaseID:FBgn0050062 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_036903.2 Gene:Lyz2 / 25211 RGDID:3026 Length:148 Species:Rattus norvegicus

Alignment Length:141 Identity:50/141 - (35%)
Similarity:69/141 - (48%) Gaps:16/141 - (11%)


  Fly     9 VRVLPLLWFLFHGIPLLAIRLQPCELAGQL--------YILDVPKSELPLWLCIAEFESRFNTHV 65
            ::.|.:|.||.....:.|...:.||.|..|        |.:     .|..|:|:|:.||.:||..
  Rat     1 MKALLVLGFLLLSASVQAKIYERCEFARTLKRNGMSGYYGV-----SLADWVCLAQHESNYNTQA 60

  Fly    66 VGQANADGSRDYGLFQISDRYWCAPPNRTEYYAFNDCNVNCTHLLSDDITMAVQCA-RLIQKQQG 129
            ......|.|.|||:|||:.||||.......  |.|.|.:.|:.||.||||.|:||| |:::..||
  Rat    61 RNYNPGDQSTDYGIFQINSRYWCNDGKTPR--AKNACGIPCSALLQDDITQAIQCAKRVVRDPQG 123

  Fly   130 WTAWSVYPEFC 140
            ..||..:...|
  Rat   124 IRAWVAWQRHC 134

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30062NP_725299.2 lysozyme_like 32..150 CDD:294153 45/118 (38%)
Lyz2NP_036903.2 LYZ1 19..147 CDD:197612 45/123 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C47802957
eggNOG 1 0.900 E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 109 1.000 Inparanoid score I4727
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1551203at2759
OrthoFinder 1 1.000 FOG0000203
OrthoInspector 1 1.000 T131092
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11407
Phylome 1 0.910 0.603 Consistency score
TreeFam 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.