DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Aa and Cpr47Eg

DIOPT Version :9

Sequence 1:NP_001097285.1 Gene:Cpr49Aa / 246413 FlyBaseID:FBgn0050045 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_610661.1 Gene:Cpr47Eg / 36196 FlyBaseID:FBgn0086519 Length:117 Species:Drosophila melanogaster


Alignment Length:134 Identity:52/134 - (38%)
Similarity:75/134 - (55%) Gaps:23/134 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQYTLLFIAALLLSLAQARPQVRGQAPGEPIPIIRQEQEVNFDGSYKYLYETGNGINAEEEGYLK 65
            |::.:.|...|.::||           .|...::|.||:||.|| :.|..|..|.:|.:::|   
  Fly     1 MKFFIAFACLLAVALA-----------NEDANVLRAEQQVNVDG-FAYAVELDNSVNVQQKG--- 50

  Fly    66 NPGTDNAGQ--VAQGSFSYTSPEGIPIRITYLADENGFQ--PQGDHLPTPPPIPPAIQKALAYLA 126
                |..|:  |.:||.|:||||.:|:.|.|:||.||:|  .....||||||||.|||::|.|:|
  Fly    51 ----DLNGEEWVVKGSQSWTSPENVPVSIQYIADANGYQVVSANPPLPTPPPIPEAIQRSLEYIA 111

  Fly   127 TAPP 130
            ..||
  Fly   112 AHPP 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AaNP_001097285.1 Chitin_bind_4 46..101 CDD:278791 21/56 (38%)
Cpr47EgNP_610661.1 Chitin_bind_4 34..84 CDD:278791 21/56 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450061
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.