DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Aa and Lcp3

DIOPT Version :9

Sequence 1:NP_001097285.1 Gene:Cpr49Aa / 246413 FlyBaseID:FBgn0050045 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_001260803.1 Gene:Lcp3 / 35819 FlyBaseID:FBgn0002534 Length:112 Species:Drosophila melanogaster


Alignment Length:70 Identity:35/70 - (50%)
Similarity:47/70 - (67%) Gaps:1/70 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 EEGYLKNPGTDNAGQVAQGSFSYTSPEGIPIRITYLADENGFQPQGDHLPTPPPIPPAIQKALAY 124
            ::|...:...|..|.: .|.|.:.||||:.:|::|.|||||:|||.|.||||||||.||.||:||
  Fly    41 DDGSASSATGDIHGNI-DGVFEWISPEGVHVRVSYKADENGYQPQSDLLPTPPPIPAAILKAIAY 104

  Fly   125 LATAP 129
            :...|
  Fly   105 IEANP 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AaNP_001097285.1 Chitin_bind_4 46..101 CDD:278791 15/40 (38%)
Lcp3NP_001260803.1 Chitin_bind_4 40..81 CDD:278791 15/40 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439310
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.