DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Aa and AgaP_AGAP012728

DIOPT Version :9

Sequence 1:NP_001097285.1 Gene:Cpr49Aa / 246413 FlyBaseID:FBgn0050045 Length:144 Species:Drosophila melanogaster
Sequence 2:XP_560629.5 Gene:AgaP_AGAP012728 / 3292280 VectorBaseID:AGAP012728 Length:207 Species:Anopheles gambiae


Alignment Length:114 Identity:59/114 - (51%)
Similarity:75/114 - (65%) Gaps:1/114 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IPIIRQEQEVNFDGSYKYLYETGNGINAEEEGYLKNPG-TDNAGQVAQGSFSYTSPEGIPIRITY 94
            :||.....:|::||||.|.|.||:|...:.:|||||.| .|...|..|||:|||||||..|.:||
Mosquito    75 VPITSYSNDVSYDGSYSYAYTTGDGQQQQAQGYLKNAGRKDLEAQAVQGSYSYTSPEGQLITVTY 139

  Fly    95 LADENGFQPQGDHLPTPPPIPPAIQKALAYLATAPPPPQEQPGGFNNRR 143
            :||||||:.:|.|||||||||.||||:||.:|...|...:....:|..|
Mosquito   140 IADENGFRAEGAHLPTPPPIPEAIQKSLALIAQTQPVSAQFNAAYNQPR 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AaNP_001097285.1 Chitin_bind_4 46..101 CDD:278791 31/55 (56%)
AgaP_AGAP012728XP_560629.5 Chitin_bind_4 90..146 CDD:278791 31/55 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.