DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Aa and CPR92

DIOPT Version :9

Sequence 1:NP_001097285.1 Gene:Cpr49Aa / 246413 FlyBaseID:FBgn0050045 Length:144 Species:Drosophila melanogaster
Sequence 2:XP_319265.3 Gene:CPR92 / 3292127 VectorBaseID:AGAP010112 Length:225 Species:Anopheles gambiae


Alignment Length:115 Identity:24/115 - (20%)
Similarity:45/115 - (39%) Gaps:19/115 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ALLLSLAQARPQVRGQAPGEPIPIIRQEQEVNFDGSYKYLYETGNGINAEEEGYLKNPGTDNAGQ 74
            |::.::||              |.|.:..|.:...:|::.|    .::.|..|.:|:....:.|.
Mosquito    70 AIVKTIAQ--------------PTIIKSVEHHAPANYEFSY----SVHDEHTGDIKSQHETHHGD 116

  Fly    75 VAQGSFSYTSPEGIPIRITYLADEN-GFQPQGDHLPTPPPIPPAIQKALA 123
            ...|.:|....:|....:.|.||.: ||.......|:...|...:.|.:|
Mosquito   117 EVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRREPSAVKIAQPVHKVIA 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AaNP_001097285.1 Chitin_bind_4 46..101 CDD:278791 12/55 (22%)
CPR92XP_319265.3 Chitin_bind_4 92..144 CDD:278791 12/55 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.