DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Aa and AgaP_AGAP010109

DIOPT Version :9

Sequence 1:NP_001097285.1 Gene:Cpr49Aa / 246413 FlyBaseID:FBgn0050045 Length:144 Species:Drosophila melanogaster
Sequence 2:XP_554005.2 Gene:AgaP_AGAP010109 / 3292125 VectorBaseID:AGAP010109 Length:140 Species:Anopheles gambiae


Alignment Length:117 Identity:29/117 - (24%)
Similarity:43/117 - (36%) Gaps:23/117 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ALLLSLAQAR--PQVRGQAPGEPIPIIRQEQEVNFDGSYKYLYETGNGINAEEEGYLKNPGTDNA 72
            ||:.|.||..  .||...||            .|::.||        .::....|.:|:......
Mosquito    36 ALVKSYAQPTYVKQVEEYAP------------ANYEFSY--------SVHDSHTGDVKSQHETRH 80

  Fly    73 GQVAQGSFSYTSPEGIPIRITYLADE-NGFQPQGDHLPTPPPIPPAIQKALA 123
            |...||.:|....:|....:.|.||: |||.......|....:...:||.:|
Mosquito    81 GDQVQGQYSLLDADGHRRIVDYTADDHNGFNAVVRREPANVKVAQPVQKVIA 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AaNP_001097285.1 Chitin_bind_4 46..101 CDD:278791 12/55 (22%)
AgaP_AGAP010109XP_554005.2 Chitin_bind_4 58..110 CDD:278791 13/59 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.