DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Aa and CPR139

DIOPT Version :9

Sequence 1:NP_001097285.1 Gene:Cpr49Aa / 246413 FlyBaseID:FBgn0050045 Length:144 Species:Drosophila melanogaster
Sequence 2:XP_003435731.1 Gene:CPR139 / 11175635 VectorBaseID:AGAP013248 Length:466 Species:Anopheles gambiae


Alignment Length:123 Identity:36/123 - (29%)
Similarity:57/123 - (46%) Gaps:36/123 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PIIRQEQEV-----NF-----DGSYKYLYE-----TGNGINAEEEGYLKNPGTDNAGQVAQGSFS 81
            ||.::.|.:     ||     .|:|.:.||     ||| :...:|..||| ||      .:||:.
Mosquito    44 PITQRVQTLDSPMYNFIDPYGPGTYAFGYEIEDPQTGN-VQFRDEEKLKN-GT------VRGSYG 100

  Fly    82 YTSPEGIPIRITYLADENGFQPQGDHLPTPPPIPPAIQKALAY-LATAP-PPPQEQPG 137
            |..|:|..|..:::|||.|::.:.:           |::|... :|:.| |.|...||
Mosquito   101 YMQPDGSVIITSFVADEGGYRAKTE-----------IRRANGQTVASFPAPAPSSAPG 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AaNP_001097285.1 Chitin_bind_4 46..101 CDD:278791 21/59 (36%)
CPR139XP_003435731.1 Chitin_bind_4 68..120 CDD:278791 21/59 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.