DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30025 and Klk13

DIOPT Version :10

Sequence 1:NP_725036.1 Gene:CG30025 / 246398 FlyBaseID:FBgn0050025 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001034131.2 Gene:Klk13 / 626834 MGIID:3615275 Length:276 Species:Mus musculus


Alignment Length:146 Identity:35/146 - (23%)
Similarity:53/146 - (36%) Gaps:41/146 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   460 ITHSHEEE------------RRQREQEMAAGF-------GAMNLSGGKGCRPPRKAHFKANLPDP 505
            :|.|.|:|            .|||:||:....       ||  :.|.:|..      .|......
Mouse     2 VTGSREQEFGQPGAMGGPQGPRQRQQELPLRILVPTQFVGA--IIGKEGLT------IKNITKQT 58

  Fly   506 DDPDDVHNRETMNDFHLAETDLMECLVRTNILERIRYILFAMKPEGATVINCTKILIRLARTSEQ 570
            ....|:|.:|.......|.|....   :....:..|.||..|:.|.    |.|||:       |:
Mouse    59 QSKVDIHRKENAGATEKAITIHSS---KEGCSQACRMILEIMEKEA----NDTKIV-------EE 109

  Fly   571 MALKIATNEALIGGLV 586
            :.|||..:.:|:|.|:
Mouse   110 VPLKILAHNSLVGRLI 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30025NP_725036.1 Tryp_SPc 30..249 CDD:214473
Klk13NP_001034131.2 Tryp_SPc 39..262 CDD:238113 26/109 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.