DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATP6V1C2 and VMA5

DIOPT Version :8

Sequence 1:XP_011508641.1 Gene:ATP6V1C2 / 245973 HGNCID:18264 Length:437 Species:Homo sapiens
Sequence 2:NP_012843.1 Gene:VMA5 / 853782 SGDID:S000001563 Length:392 Species:Saccharomyces cerevisiae

Alignment Length:452 Identity:137/453 (30%)
Similarity:225/453 (50%) Gaps:88/453 (19%)


Human     2 SEFWLISAPGDKENLQALERMNTVTSK-------SNLSYNTKFAIPDFKVGTLDSLVGLSDELGK 59
            ::|.|||.|   :|.|.:....:.|..       ...::.:.|.||:||:|:||:|:..|:||.|
Yeast     9 NDFILISLP---QNAQPVTAPGSKTDSWFNETLIGGRAFVSDFKIPEFKIGSLDTLIVESEELSK 70

Human    60 LDTFAESLIRRMAQSVVEVMEDSKGKVQEHLLANGGLKGKMKCLKID---LTSFVTHFEWDMAKY 121
            :|       .::..|:.:::|..:|       .|.......:.|.|:   :..::.:|:|...|:
Yeast    71 VD-------NQIGASIGKIIEILQG-------LNETSTNAYRTLPINNMPVPEYLENFQWQTRKF 121

Human   122 PVKQPLVSVVDTIAKQLAQIEMDLKSRTAAYNTLKTNLENLEKKSMGNLFTRTLSDIVSKEDFVL 186
            .:.:.:..::..|:.:.:|::.|:::..|.||:.||||...|:|..|:|..|:|.|||..|||||
Yeast   122 KLDKSIKDLITLISNESSQLDADVRATYANYNSAKTNLAAAERKKTGDLSVRSLHDIVKPEDFVL 186

Human   187 DSEYLVTLLVIVPKPNYSQWQKTYESLSDMVVPRSTKLITEDKEGGLFTVTLFRKVIEDFKTKAK 251
            :||:|.|:||.|||...|.::|:||:||..|||.|..:|.||.|..||.|.||:|.:::|.|.|:
Yeast   187 NSEHLTTVLVAVPKSLKSDFEKSYETLSKNVVPASASVIAEDAEYVLFNVHLFKKNVQEFTTAAR 251

Human   252 ENKFTVREFYYDEK---EIEREREEMARLLSDKKQQYQTSCVALKKGSSTFPDHKVKVTPLGNPD 313
            |.||..|||.|.|:   ::::|.:..|.|....:.|                             
Yeast   252 EKKFIPREFNYSEELIDQLKKEHDSAASLEQSLRVQ----------------------------- 287

Human   314 RPAAGQTDRERESEGEGEGPLLRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAVLLQP 378
                                |:|..|..:.:.||.|.|||||||:||||||||||.:|...::..
Yeast   288 --------------------LVRLAKTAYVDVFINWFHIKALRVYVESVLRYGLPPHFNIKIIAV 332

Human   379 HKKSSTKRLREVLNSVFRHL-------DEVAATSILDASVEIPGLQLNNQDYFPYVYFHIDL 433
            ..|:.:|...|:::: |..|       |:....:..|.|:. ....|.:.:|.|:|.:.|:|
Yeast   333 PPKNLSKCKSELIDA-FGFLGGNAFMKDKKGKINKQDTSLH-QYASLVDTEYEPFVMYIINL 392

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATP6V1C2XP_011508641.1 V-ATPase_C 5..427 CDD:308707 133/442 (30%)
3-helical coiled coil 55..75 CDD:270211 5/20 (25%)
3-helical coiled coil 130..156 CDD:270211 6/26 (23%)
3-helical coiled coil 284..361 CDD:270211 16/77 (21%)
VMA5NP_012843.1 COG5127 6..392 CDD:227456 136/451 (30%)
3-helical coiled coil 66..86 CDD:270211 6/27 (22%)
3-helical coiled coil 130..156 CDD:270211 6/26 (23%)
3-helical coiled coil 284..315 CDD:270211 16/80 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C34193925
eggNOG 1 0.900 E1_COG5127
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 228 1.000 Inparanoid score I827
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001431
OrthoInspector 1 1.000 T1003900
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10137
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1630
TreeFam 1 0.960
1110.890

Return to query results.
Submit another query.