DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATP6V1C2 and Atp6v1c2

DIOPT Version :8

Sequence 1:XP_011508641.1 Gene:ATP6V1C2 / 245973 HGNCID:18264 Length:437 Species:Homo sapiens
Sequence 2:NP_001153104.1 Gene:Atp6v1c2 / 68775 MGIID:1916025 Length:437 Species:Mus musculus

Alignment Length:437 Identity:401/438 (92%)
Similarity:416/438 (95%) Gaps:0/438 (0%)


Human     1 MSEFWLISAPGDKENLQALERMNTVTSKSNLSYNTKFAIPDFKVGTLDSLVGLSDELGKLDTFAE 65
            |||||||||||||||||||||||.||||||||:||||||||||||||||||||||||||||||||
Mouse     1 MSEFWLISAPGDKENLQALERMNNVTSKSNLSHNTKFAIPDFKVGTLDSLVGLSDELGKLDTFAE 65

Human    66 SLIRRMAQSVVEVMEDSKGKVQEHLLANGGLKGKMKCLKIDLTSFVTHFEWDMAKYPVKQPLVSV 130
            |||:||||||||||||||||..|.||||||||.||||||||||||||||||||||||.|||||||
Mouse    66 SLIKRMAQSVVEVMEDSKGKAHETLLANGGLKEKMKCLKIDLTSFVTHFEWDMAKYPAKQPLVSV 130

Human   131 VDTIAKQLAQIEMDLKSRTAAYNTLKTNLENLEKKSMGNLFTRTLSDIVSKEDFVLDSEYLVTLL 195
            |||:||||||||.|||||||||:.||.|||||||:|.||||||||||||||||||||||||:|||
Mouse   131 VDTLAKQLAQIETDLKSRTAAYSVLKANLENLEKRSTGNLFTRTLSDIVSKEDFVLDSEYLITLL 195

Human   196 VIVPKPNYSQWQKTYESLSDMVVPRSTKLITEDKEGGLFTVTLFRKVIEDFKTKAKENKFTVREF 260
            |||||.:::|||||||||||||||||||||.||.||||||||||||||||||.|||||||.||||
Mouse   196 VIVPKSSFAQWQKTYESLSDMVVPRSTKLIAEDNEGGLFTVTLFRKVIEDFKVKAKENKFIVREF 260

Human   261 YYDEKEIEREREEMARLLSDKKQQYQTSCVALKKGSSTFPDHKVKVTPLGNPDRPAAGQTDRERE 325
            |||||||:||||||.||||||||||.||||||||||:|:.||||||.|||||.|||||||||:||
Mouse   261 YYDEKEIKREREEMTRLLSDKKQQYPTSCVALKKGSATYRDHKVKVAPLGNPARPAAGQTDRDRE 325

Human   326 SEGEGEGPLLRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAVLLQPHKKSSTKRLREV 390
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||:|||||||
Mouse   326 SEGEGEGPLLRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAVLLQPHKKSATKRLREV 390

Human   391 LNSVFRHLDEVAATSILDASVEIPGLQLNNQDYFPYVYFHIDLSLLD 437
            |||||||||||||.||||||||||||||:||||||||||||||||||
Mouse   391 LNSVFRHLDEVAAASILDASVEIPGLQLSNQDYFPYVYFHIDLSLLD 437

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATP6V1C2XP_011508641.1 V-ATPase_C 5..427 CDD:308707 386/422 (91%)
3-helical coiled coil 55..75 CDD:270211 19/20 (95%)
3-helical coiled coil 130..156 CDD:270211 22/26 (85%)
3-helical coiled coil 284..361 CDD:270211 70/77 (91%)
Atp6v1c2NP_001153104.1 V-ATPase_C 5..427 CDD:281248 386/422 (91%)
3-helical coiled coil 55..75 CDD:270211 19/20 (95%)
3-helical coiled coil 130..156 CDD:270211 22/26 (85%)
3-helical coiled coil 284..361 CDD:270211 70/77 (91%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C33930683
eggNOG 1 0.900 E1_COG5127
HGNC 1 1.500
Hieranoid 1 1.000
Homologene 1 1.000 H15866
Inparanoid 1 1.050 775 1.000 Inparanoid score I8096
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001431
OrthoInspector 1 1.000 T2444629
orthoMCL 1 0.900 OOG5_150069
Panther 1 1.100 LDO PTHR10137
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1630
TreeFam 1 0.960
1414.290

Return to query results.
Submit another query.