DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATP6V1C2 and Vha44

DIOPT Version :8

Sequence 1:XP_011508641.1 Gene:ATP6V1C2 / 245973 HGNCID:18264 Length:437 Species:Homo sapiens
Sequence 2:NP_001137679.1 Gene:Vha44 / 36826 FlyBaseID:FBgn0262511 Length:836 Species:Drosophila melanogaster

Alignment Length:878 Identity:225/879 (26%)
Similarity:302/879 (34%) Gaps:488/879 (56%)


Human     1 MSEFWLISAPGDKENLQALERMNTVTSKS-NLSYNTKFAIPDFKVGTLDSLVGLSDELGKLDTFA 64
            |||:|:|||||||...|..:.||.:|||. ||..|.||.|||.||||||.||||||:||||||:.
  Fly     2 MSEYWIISAPGDKTCQQTYDTMNNLTSKQHNLCNNYKFHIPDLKVGTLDQLVGLSDDLGKLDTYV 66

Human    65 ESLIRRMAQSVVEVMEDSKGKVQEHLLANGG---------------------------------- 95
            |.:.|::|..:.||:||.:.|:.|:|:||..                                  
  Fly    67 EQITRKVANYLGEVLEDQRDKLHENLMANNSPGPPDDSMPCRHHQRIKHLSLRHQRKHQHTHHQN 131

Human    96 -----------------LKGK-------------------------------------------- 99
                             ||||                                            
  Fly   132 KPQHYHHHHHHHQLPQDLKGKSAATCSPATPPAPASAPPHLPPACACDVLAPGSLTGGSLTNLST 196

Human   100 -----------------------------------------------MKC--------------- 102
                                                           .:|               
  Fly   197 SHEPEPEFDVCPCDECFACAPPSTSATASTLLADECYSQTASSMLSATRCALSTVAAIATGSGLG 261

Human   103 ----------------------------------------------------------------- 102
                                                                             
  Fly   262 NGPSTSAAAAAAASNSSGGGGGGGPASCSTLCSSAYFSTSAPTTSSSVHSSMSRSNSKRLNNNTC 326

Human   103 ----------------------------------------------------------------- 102
                                                                             
  Fly   327 SINNNKLSFRSGSHVSQLHLATQQPQHHHSHPHQQPHTNPLQSPVQKSMSEDEGDASNAHEDGET 391

Human   103 ----------------------------------------------------------------- 102
                                                                             
  Fly   392 DEDPKSPHSVQSDLSDAFDWWFNKPKRNSKKSSAQQQHETAQLQHQQTTQQHATPLTPQNHNQYQ 456

Human   103 ------------------------------------------LKI-------------------- 105
                                                      |.|                    
  Fly   457 NQHLSKAMTFWHQASTTPRSSYRSFFNSLADQIYSKRSTPSQLNINNGFNLTPTHRSSPVSSCCG 521

Human   106 ------------------------DLTSFVTHFEWDMAKYPVKQPLVSVVDTIAKQLAQIEMDLK 146
                                    :|..::|.|:|||||||:||.|.::.|.|:||:.||:.|||
  Fly   522 SSSQGRSSPDTDPAEPPEFPLSPAELPQYLTRFQWDMAKYPIKQSLRNIADIISKQIGQIDGDLK 586

Human   147 SRTAAYNTLKTNLENLEKKSMGNLFTRTLSDIVSKEDFVLDSEYLVTLLVIVPKPNYSQWQKTYE 211
            :::.|||.||.||:|||||..|:|.||.|:|:|.||.|:||||||.||||||||...:.|...||
  Fly   587 TKSQAYNNLKGNLQNLEKKKTGSLLTRNLADLVKKEHFILDSEYLTTLLVIVPKVMANDWLTNYE 651

Human   212 SLSDMVVPRSTKLITEDKEGGLFTVTLFRKVIEDFKTKAKENKFTVREFYYDEKEIEREREEMAR 276
            .::||:||||::||.||.:..||.||||:||.|:||..|:|.||.||:|.|:|:|:...:.||.:
  Fly   652 KITDMIVPRSSQLIQEDADYCLFNVTLFKKVAEEFKLHARERKFIVRDFVYNEEELAAGKNEMTK 716

Human   277 LLSDKKQQYQTSCVALKKGSSTFPDHKVKVTPLGNPDRPAAGQTDRERESEGEGEGPLLRWLKVN 341
            |::|||:|:                                              |||:||||||
  Fly   717 LMTDKKKQF----------------------------------------------GPLVRWLKVN 735

Human   342 FSEAFIAWIHIKALRVFVESVLRYGLPVNFQAVLLQPHKKSSTKRLREVLNSVFRHLDEVAATSI 406
            |||||.|.||:|||||||||||||||||||||:|::|:|| |.||||:|||.::.|||..:|...
  Fly   736 FSEAFCALIHVKALRVFVESVLRYGLPVNFQAILIEPNKK-SVKRLRDVLNQLYGHLDGASAGGA 799

Human   407 LDA--SVEIPGLQLNNQDYFPYVYFHIDLSLLD 437
            :.:  :|:||||.....:|||||::.:::.:::
  Fly   800 VSSADNVDIPGLGFGQSEYFPYVFYKVNIDMVE 832

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATP6V1C2XP_011508641.1 V-ATPase_C 5..427 CDD:308707 221/863 (26%)
3-helical coiled coil 55..75 CDD:270211 10/20 (50%)
3-helical coiled coil 130..156 CDD:270211 13/26 (50%)
3-helical coiled coil 284..361 CDD:270211 26/77 (34%)
Vha44NP_001137679.1 V-ATPase_C 6..>98 CDD:301617 52/92 (57%)
3-helical coiled coil 57..77 CDD:270211 10/20 (50%)
V-ATPase_C <547..822 CDD:281248 162/322 (50%)
3-helical coiled coil 570..596 CDD:270211 13/26 (50%)
3-helical coiled coil 724..755 CDD:270211 26/77 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C34172251
eggNOG 1 0.900 E1_COG5127
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1016088at2759
OrthoFinder 1 1.000 FOG0001431
OrthoInspector 1 1.000 T609581
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10137
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1630
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
109.840

Return to query results.
Submit another query.