DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATP6V1C2 and Atp6v1c2

DIOPT Version :8

Sequence 1:XP_011508641.1 Gene:ATP6V1C2 / 245973 HGNCID:18264 Length:437 Species:Homo sapiens
Sequence 2:NP_001014221.1 Gene:Atp6v1c2 / 362802 RGDID:1359430 Length:425 Species:Rattus norvegicus

Alignment Length:437 Identity:393/438 (90%)
Similarity:407/438 (93%) Gaps:12/438 (3%)


Human     1 MSEFWLISAPGDKENLQALERMNTVTSKSNLSYNTKFAIPDFKVGTLDSLVGLSDELGKLDTFAE 65
            |||||||||||||||||||||||:||||||||:||||||||||||||||||||||||||||||||
  Rat     1 MSEFWLISAPGDKENLQALERMNSVTSKSNLSHNTKFAIPDFKVGTLDSLVGLSDELGKLDTFAE 65

Human    66 SLIRRMAQSVVEVMEDSKGKVQEHLLANGGLKGKMKCLKIDLTSFVTHFEWDMAKYPVKQPLVSV 130
            |||:|||||||||||||||||.|:|||||          :|||||||||||||||||.|||||||
  Rat    66 SLIKRMAQSVVEVMEDSKGKVHENLLANG----------VDLTSFVTHFEWDMAKYPAKQPLVSV 120

Human   131 VDTIAKQLAQIEMDLKSRTAAYNTLKTNLENLEKKSMGNLFTRTLSDIVSKEDFVLDSEYLVTLL 195
            |||:||||||||.|||||||||:.||.|||||||||.||||||||||||||||||||||||:|||
  Rat   121 VDTLAKQLAQIETDLKSRTAAYSVLKANLENLEKKSTGNLFTRTLSDIVSKEDFVLDSEYLITLL 185

Human   196 VIVPKPNYSQWQKTYESLSDMVVPRSTKLITEDKEGGLFTVTLFRKVIEDFKTKAKENKFTVREF 260
            |||||.:|.|||||||||||||||||||||.||.||||||||||||||||||.|||||||.||||
  Rat   186 VIVPKSSYVQWQKTYESLSDMVVPRSTKLIAEDNEGGLFTVTLFRKVIEDFKVKAKENKFIVREF 250

Human   261 YYDEKEIEREREEMARLLSDKKQQYQTSCVALKKGSSTFPDHKVKVTPLGNPDRPAAGQTDRERE 325
            |||||||:||||||.|||||||||||||||||||||:|:.||||||||||||.||.|||.|  ||
  Rat   251 YYDEKEIKREREEMTRLLSDKKQQYQTSCVALKKGSATYRDHKVKVTPLGNPTRPTAGQND--RE 313

Human   326 SEGEGEGPLLRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAVLLQPHKKSSTKRLREV 390
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||:|||||||
  Rat   314 SEGEGEGPLLRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAVLLQPHKKSATKRLREV 378

Human   391 LNSVFRHLDEVAATSILDASVEIPGLQLNNQDYFPYVYFHIDLSLLD 437
            |||||||||||||.||||||||||||||:||||||||||||||||||
  Rat   379 LNSVFRHLDEVAAASILDASVEIPGLQLSNQDYFPYVYFHIDLSLLD 425

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATP6V1C2XP_011508641.1 V-ATPase_C 5..427 CDD:308707 378/422 (90%)
3-helical coiled coil 55..75 CDD:270211 19/20 (95%)
3-helical coiled coil 130..156 CDD:270211 22/26 (85%)
3-helical coiled coil 284..361 CDD:270211 69/77 (90%)
Atp6v1c2NP_001014221.1 V-ATPase_C 5..415 CDD:281248 378/422 (90%)
3-helical coiled coil 55..75 CDD:270211 19/20 (95%)
3-helical coiled coil 120..146 CDD:270211 22/26 (85%)
3-helical coiled coil 274..349 CDD:270211 69/77 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C33923349
eggNOG 1 0.900 E1_COG5127
HGNC 1 1.500
Hieranoid 1 1.000
Homologene 1 1.000 H15866
Inparanoid 1 1.050 774 1.000 Inparanoid score I7584
OMA 1 1.010
OrthoDB 1 1.010 D1016088at2759
OrthoFinder 1 1.000 FOG0001431
OrthoInspector 1 1.000 T2461061
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR10137
Phylome 1 0.910 0.800 Consistency score
TreeFam 00.000 Not matched by this tool.
1212.410

Return to query results.
Submit another query.