DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATP6V1C2 and vma5

DIOPT Version :8

Sequence 1:XP_011508641.1 Gene:ATP6V1C2 / 245973 HGNCID:18264 Length:437 Species:Homo sapiens
Sequence 2:NP_593891.1 Gene:vma5 / 2543469 PomBaseID:SPAPB2B4.05 Length:394 Species:Schizosaccharomyces pombe

Alignment Length:445 Identity:131/446 (29%)
Similarity:227/446 (51%) Gaps:76/446 (17%)


Human     2 SEFWLISAP---GDKENL-QALERMNTVTSKSNLSYNTKFAIPDFKVGTLDSLVGLSDELGKLDT 62
            |:||::|.|   |...:| ..:||:....|.|.:|....|.:|.|||.:||.|:..|::|.|.|.
pombe     4 SDFWILSVPSRGGSNADLCDDIERLLVSGSTSLISTVAPFDVPPFKVESLDVLISQSEQLTKQDA 68

Human    63 FAESLIRRMAQSVVEVMEDSKGKVQEHLLANGGLKGKMKCLKIDLTSFVTHFEWDMAKYPVKQPL 127
            ...|.|.:::..:...:..|.|.::::.:...  |..::        :|:.|.|:.:::.:.:.:
pombe    69 QCASAISKISDIIKNTVSSSSGDLKDYFMVQD--KSPLE--------YVSSFAWNSSRFHMNKTI 123

Human   128 VSVVDTIAKQLAQIEMDLKSRTAAYNTLKTNLENLEKKSMGNLFTRTLSDIVSKEDFVLDSEYLV 192
            ..:.|.|..::...|.|:::|..::....:..:|::||..|||..::|::||.:||.|..|:||.
pombe   124 SEISDRITSEIISFENDIRTRQTSFQQASSAFQNMQKKQSGNLSQKSLANIVHEEDVVHGSDYLT 188

Human   193 TLLVIVPKPNYSQWQKTYESLSDMVVPRSTKLITEDKEGGLFTVTLFRKVIEDFKTKAKENKFTV 257
            .:.:.||.....|:..:||:|:|:|:|||.|.:.:|.|..|:||.:|:|..:.|.|||:|.|:|:
pombe   189 NVFIAVPLNLEKQFLNSYETLTDLVIPRSAKKLDQDSEFVLYTVVVFKKTADSFITKAREAKYTI 253

Human   258 REFYYDEKEIEREREEMARLLSDKKQQYQTSCVALKKGSSTFPDHKVKVTPLGNPDRPAAGQTDR 322
            |||.:::...|.|:.|                         |.|..||                 
pombe   254 REFTFEQGLRETEQSE-------------------------FDDAAVK----------------- 276

Human   323 ERESEGEGEGPLLRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAVLLQPHKKSSTKRL 387
                |......|||:..:.|||:|..|||:|.|.|:|||:||||||.:|.:|:.||..||..| :
pombe   277 ----EKRMLSSLLRYASIAFSESFQGWIHLKCLCVYVESILRYGLPPDFSSVIFQPMAKSEVK-I 336

Human   388 REVLNSVFRHLDE----------VAATSILDASVEIPGLQLN-NQDYFPYVYFHI 431
            :.:|.|.:.:|.:          |.:::.||.|:    ..|| :::|.|:|.|.:
pombe   337 KNILLSKYAYLAQNPVGNNKVKNVDSSAGLDESM----ADLNLDEEYLPFVLFTV 387

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATP6V1C2XP_011508641.1 V-ATPase_C 5..427 CDD:308707 127/437 (29%)
3-helical coiled coil 55..75 CDD:270211 5/20 (25%)
3-helical coiled coil 130..156 CDD:270211 5/26 (19%)
3-helical coiled coil 284..361 CDD:270211 20/77 (26%)
vma5NP_593891.1 COG5127 1..394 CDD:227456 131/446 (29%)
3-helical coiled coil 61..81 CDD:270211 5/20 (25%)
3-helical coiled coil 126..152 CDD:270211 5/26 (19%)
3-helical coiled coil 280..311 CDD:270211 15/31 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 219 1.000 Inparanoid score I1026
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001431
OrthoInspector 1 1.000 T998651
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10137
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1630
TreeFam 1 0.960
99.060

Return to query results.
Submit another query.