DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATP6V1C2 and vha-11

DIOPT Version :8

Sequence 1:XP_011508641.1 Gene:ATP6V1C2 / 245973 HGNCID:18264 Length:437 Species:Homo sapiens
Sequence 2:NP_001023451.1 Gene:vha-11 / 177017 WormBaseID:WBGene00006920 Length:384 Species:Caenorhabditis elegans

Alignment Length:436 Identity:193/437 (44%)
Similarity:280/437 (64%) Gaps:61/437 (14%)


Human     3 EFWLISAPGDKENLQALERMNTVTSKSNLSYNTKFAIPDFKVGTLDSLVGLSDELGKLDTFAESL 67
            |:||||.||:|....|.:::|  .|..|.|.|:|:.|||.||||||.||||||:|.||||.||::
 Worm     8 EYWLISVPGEKGANDAWDKLN--RSTGNTSTNSKYLIPDLKVGTLDQLVGLSDDLSKLDTSAEAV 70

Human    68 IRRMAQSVVEVMEDSKGKVQEHLLANGGLKGKMKCLKIDLTSFVTHFEWDMAKYPVKQPLVSVVD 132
            ||::.|...||:|:.|.|:.|:|:.  |.|        |:.::||.|:|:.||||:||.|..:.:
 Worm    71 IRKLVQYFTEVLEEDKSKIAENLVI--GNK--------DMKTYVTKFQWEGAKYPLKQSLKVLSE 125

Human   133 TIAKQLAQIEMDLKSRTAAYNTLKTNLENLEKKSMGNLFTRTLSDIVSKEDFVLDSEYLVTLLVI 197
            .|.||::||:.|||.::..||.||..|.::::|::|:|.|:.|:|:|..:||||:||||.|::|:
 Worm   126 IIGKQISQIDNDLKVKSLTYNNLKNALASMDRKTVGSLLTKDLADLVKADDFVLNSEYLQTVIVV 190

Human   198 VPKPNYSQWQKTYESLSDMVVPRSTKLITEDKEGGLFTVTLFRKVIEDFKTKAKENKFTVREFYY 262
            |||.:..:|::.|.:||.||||.|:||:||:.|..|:|||||:|||::||..|:||||.||:|.|
 Worm   191 VPKISVKEWEQKYATLSSMVVPGSSKLLTEEGEHALYTVTLFKKVIDEFKNTARENKFIVRDFVY 255

Human   263 DEKEIEREREEMARLLSDKKQQYQTSCVALKKGSSTFPDHKVKVTPLGNPDRPAAGQTDRERESE 327
            ||:.::..|.|..:|:::|::||                                          
 Worm   256 DEETLKAGRTERDKLMAEKQRQY------------------------------------------ 278

Human   328 GEGEGPLLRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAVLLQPHKKSSTKRLREVLN 392
                .||:||||:||.|.|.|:||||||||||||||||||||||||.:::| .|...|:||:.|:
 Worm   279 ----APLIRWLKINFGEIFAAYIHIKALRVFVESVLRYGLPVNFQAAVIEP-AKGQQKKLRQELH 338

Human   393 SVFRHLDEVAATSILDASVEIPGL-QLNNQDYFPYVYFHIDLSLLD 437
            .::.|||..||..| |...:.|.| .|...:|:|||:|.:::..|:
 Worm   339 KLYIHLDGSAAGPI-DTLEDSPALMSLGVNEYYPYVFFKLNIDFLN 383

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATP6V1C2XP_011508641.1 V-ATPase_C 5..427 CDD:308707 189/423 (45%)
3-helical coiled coil 55..75 CDD:270211 11/20 (55%)
3-helical coiled coil 130..156 CDD:270211 11/26 (42%)
3-helical coiled coil 284..361 CDD:270211 24/77 (31%)
vha-11NP_001023451.1 V-ATPase_C 10..373 CDD:281248 189/423 (45%)
3-helical coiled coil 58..78 CDD:270211 11/20 (55%)
3-helical coiled coil 123..149 CDD:270211 11/26 (42%)
3-helical coiled coil 277..308 CDD:270211 24/77 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C34183674
eggNOG 1 0.900 E1_COG5127
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 437 1.000 Inparanoid score I1019
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1016088at2759
OrthoFinder 1 1.000 FOG0001431
OrthoInspector 1 1.000 T389724
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10137
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1630
TreeFam 1 0.960
1110.890

Return to query results.
Submit another query.