DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATP6V1C2 and atp6v1c2

DIOPT Version :8

Sequence 1:XP_011508641.1 Gene:ATP6V1C2 / 245973 HGNCID:18264 Length:437 Species:Homo sapiens
Sequence 2:XP_002940167.1 Gene:atp6v1c2 / 100485790 XenbaseID:XB-GENE-962058 Length:381 Species:Xenopus tropicalis

Alignment Length:437 Identity:274/438 (63%)
Similarity:334/438 (76%) Gaps:57/438 (13%)


Human     1 MSEFWLISAPGDKENLQALERMNTVTSKSNLSYNTKFAIPDFKVGTLDSLVGLSDELGKLDTFAE 65
            |||.||||.||||.||.||:||||||||:|||.|.||.||:.||||||:||||||||||||.:||
 Frog     1 MSELWLISVPGDKTNLTALDRMNTVTSKANLSSNAKFVIPELKVGTLDALVGLSDELGKLDAYAE 65

Human    66 SLIRRMAQSVVEVMEDSKGKVQEHLLANGGLKGKMKCLKIDLTSFVTHFEWDMAKYPVKQPLVSV 130
            |||:::||.:.|||:||..|.||:|||||          :||.|::..||||||||||||||.::
 Frog    66 SLIKKIAQYIGEVMDDSTDKAQENLLANG----------VDLISYLARFEWDMAKYPVKQPLKNI 120

Human   131 VDTIAKQLAQIEMDLKSRTAAYNTLKTNLENLEKKSMGNLFTRTLSDIVSKEDFVLDSEYLVTLL 195
            ::.::||::||:.|||||::|||.:|.:|::||:|::|||.||||:|||:|||||||||||||||
 Frog   121 MEVLSKQMSQIDTDLKSRSSAYNNIKGSLQSLERKTVGNLLTRTLADIVNKEDFVLDSEYLVTLL 185

Human   196 VIVPKPNYSQWQKTYESLSDMVVPRSTKLITEDKEGGLFTVTLFRKVIEDFKTKAKENKFTVREF 260
            |:|||.:|..||||||||||||||||||:|.||.|||||||||||||::|||.||:||||.||||
 Frog   186 VVVPKSSYGAWQKTYESLSDMVVPRSTKMIAEDAEGGLFTVTLFRKVMDDFKAKARENKFIVREF 250

Human   261 YYDEKEIEREREEMARLLSDKKQQYQTSCVALKKGSSTFPDHKVKVTPLGNPDRPAAGQTDRERE 325
            .::|||::.|:.|:.:|.:||||.|                                        
 Frog   251 LFNEKELQSEKAEIVKLAADKKQLY---------------------------------------- 275

Human   326 SEGEGEGPLLRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAVLLQPHKKSSTKRLREV 390
                  ||||||||||||||||.||||||||||||||||||||||||||:|||:|| |.||||:|
 Frog   276 ------GPLLRWLKVNFSEAFIGWIHIKALRVFVESVLRYGLPVNFQAVVLQPNKK-SMKRLRDV 333

Human   391 LNSVFRHLDEVAATSILDASVEIPGLQLNNQDYFPYVYFHIDLSLLD 437
            ||::||||||.||.::.|..:|||||||::|||:|||.|.|||:.||
 Frog   334 LNAIFRHLDENAAANMKDIGMEIPGLQLSSQDYYPYVCFKIDLTNLD 380

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATP6V1C2XP_011508641.1 V-ATPase_C 5..427 CDD:308707 264/422 (63%)
3-helical coiled coil 55..75 CDD:270211 14/20 (70%)
3-helical coiled coil 130..156 CDD:270211 12/26 (46%)
3-helical coiled coil 284..361 CDD:270211 29/77 (38%)
atp6v1c2XP_002940167.1 V-ATPase_C 5..370 CDD:281248 264/422 (63%)
3-helical coiled coil 55..75 CDD:270211 14/20 (70%)
3-helical coiled coil 120..146 CDD:270211 12/26 (46%)
3-helical coiled coil 274..305 CDD:270211 29/77 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C34021581
eggNOG 1 0.900 E1_COG5127
Hieranoid 1 1.000
Homologene 1 1.000 H15866
Inparanoid 1 1.050 540 1.000 Inparanoid score I6614
OMA 1 1.010
OrthoDB 1 1.010 D1016088at2759
OrthoFinder 1 1.000 FOG0001431
OrthoInspector 1 1.000 T1884517
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1630
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.