DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hoxc8 and Antp

Sequence 1:NP_001170797.2 Gene:Hoxc8 RGDID:2821 Length:242 Species:Rattus norvegicus
Sequence 2:NP_996167.1 Gene:Antp FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster

Alignment Length:219 Identity:86/220 (39%)
Similarity:110/220 (50%) Gaps:32/220 (15%)


  Rat    23 YYDCRFPQSVGRSHALVYGPGGSAPGF--QHASHHV---QDFFHHGTSGISNSGY---------- 72
            |..|:...:||   .|...|.|.:|..  |.:.||:   ....||.....:..||          
  Fly   159 YASCKLQAAVG---GLGMVPEGGSPPLVDQMSGHHMNAQMTLPHHMGHPQAQLGYTDVGVPDVTE 220

  Rat    73 -QQNPCSLSCHGDASKFYGYEALPRQSLYGAQQEASVVQ-YP--DCKSSANTNSSEGQGHLNQNS 133
             .||..::..:...|......|.|:..::..|....:.| :|  ....|.|.||       ..:.
  Fly   221 VHQNHHNMGMYQQQSGVPPVGAPPQGMMHQGQGPPQMHQGHPGQHTPPSQNPNS-------QSSG 278

  Rat   134 SPSLMFPWMRPH---APGRRSGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKI 195
            .||.::||||..   ...|:.|||||:|||||||||||.||.||||:||||::|||.|||||:||
  Fly   279 MPSPLYPWMRSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKI 343

  Rat   196 WFQNRRMKWKKENNKDKLPGARDE 219
            |||||||||||||.....||:..|
  Fly   344 WFQNRRMKWKKENKTKGEPGSGGE 367

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hoxc8NP_001170797.2 Homeobox 153..206 CDD:333795 45/53 (85%)
AntpNP_996167.1 Homeobox 301..353 CDD:278475 44/52 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.645 Consistency score
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.