DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ces1c and Gli

Sequence 1:XP_006255234.1 Gene:Ces1c RGDID:2571 Length:551 Species:Rattus norvegicus
Sequence 2:NP_476602.1 Gene:Gli FlyBaseID:FBgn0001987 Length:956 Species:Drosophila melanogaster

Alignment Length:599 Identity:182/600 (30%)
Similarity:279/600 (47%) Gaps:98/600 (16%)


  Rat    28 VDTTKGKVLGKYVSL------EGFTQP-----------VAVFLGVPFAKPPLGSLRFAPPEPAEP 75
            |.|..|:|.|..|.:      :.|.:|           .:||||:|:|.||....||.||.....
  Fly   137 VTTNYGQVQGFKVYMYDNPDPKSFYRPYHSTVDRVMGECSVFLGIPYALPPTFEGRFKPPRVHRG 201

  Rat    76 WSFVKNTTTYPPMCSQDGVVGKLLADMLSTGKENIPLEFSEDCLYLNIYSP---ADLTKNSRLPV 137
            |..:: ...:.|.|.|         .:..||.....::..|||||||:|||   |.:.:  :.||
  Fly   202 WQLLQ-AVDFGPACPQ---------PVRYTGATKGIMDMDEDCLYLNVYSPKTGAGVAQ--KYPV 254

  Rat   138 MVWIHGGGLITGRASPYSGIALSAHENVVVVTIQYHLGIWGLFSTGDEHSRGNWAHLDQLAALRW 202
            ||:||||..|.|.::.:.|..|::..:|||||:.|.||..|..|||||:|.||:..|||..||||
  Fly   255 MVYIHGGEFIRGASNLFQGHILASFYDVVVVTLNYRLGALGFLSTGDENSPGNYGILDQAMALRW 319

  Rat   203 VQDNIANFGGNPDSVTIFGESAGGVSVSVLVLSPLAKNLFHRAISESGVVL---TTNLDKKNTQA 264
            |.|||..|.|:.:|:|:||..|||.|..:|:::|..:|:..|.|::||..|   ....||...|.
  Fly   320 VYDNIEFFNGDRNSITLFGPGAGGASAGLLMVAPQTRNIVRRVIAQSGSALADWALIQDKYRAQN 384

  Rat   265 VAQMIATLSGCNNTSSAAMVQCLRQ-KTEAEL--LELTVKLDNTSMSTVID-GVVLP-------- 317
            .::::..|.||:..||..:|.|||. ::..||  .|.:.::.:.....|:| ...||        
  Fly   385 TSRVLGQLLGCSIESSWKLVNCLRTGRSFYELGNAEFSPQVGSFPWGPVLDHNFTLPGDDWYEGW 449

  Rat   318 ---------KTPEEILTEKSFN-TVPYIVGFNKQEFGWIIPTMMGNLLS-----EGRMNEKMASS 367
                     :|||.::....|| .:.|:.|...||..:.:  .....||     :||..::....
  Fly   450 REKDWRFLTQTPETLIRAGKFNRNIQYMTGVTTQEAAFFV--AQNESLSPYYELDGRFFDQKIRE 512

  Rat   368 LLRRFSPNLNISESVIPAIIEKYL-RGTHDPAKK---KELLLDMFSDVFFGIPAVLMSRSLRDGG 428
            .:.|::..|| ...|..||  ||: ....||...   ::..::|.||:::..|...|.:.:.:..
  Fly   513 HVFRYNYTLN-PNGVYEAI--KYIYTFWPDPNNNTIIRDQYINMLSDLYYRAPVDQMVKLMLEQK 574

  Rat   429 APTYMYEFQYRPSFVSDHRPQTVQGDHGDEIFSVFGTPFL-------KEGA-----SEEETNLSK 481
            .|.|||..  ..:..:.:.||..:..|..|.:.:.|.||:       ||..     ::.:.|:|.
  Fly   575 VPVYMYVL--NTTVEALNLPQWRKYPHDIERYFLTGAPFMDTEFFPKKEHLQRNMWTDNDRNMSH 637

  Rat   482 LVMKFWANFARNGNPNGE---GLPHWPEYDQKEGYLQIGATTQQAQKL--KGEEVAFWTE----- 536
            ..|:.:.||||.|||..:   |:.....|..:..||.|..|...:..|  :..|.||||:     
  Fly   638 FFMQTYTNFARYGNPTPQQVLGMHFQRAYQGEIRYLNINTTYNSSILLNYRQTECAFWTQYLPTV 702

  Rat   537 ---LLAKNPPQTEH 547
               |:...||.||:
  Fly   703 IGVLVPTYPPTTEY 716

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ces1cXP_006255234.1 COesterase 26..534 CDD:278561 175/577 (30%)
Aes 45..>241 CDD:223730 84/210 (40%)
GliNP_476602.1 COesterase 134..695 CDD:278561 175/577 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D754103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.