DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp4b1 and Cyp4d20

Sequence 1:NP_058695.2 Gene:Cyp4b1 RGDID:2480 Length:511 Species:Rattus norvegicus
Sequence 2:NP_647723.2 Gene:Cyp4d20 FlyBaseID:FBgn0035344 Length:510 Species:Drosophila melanogaster

Alignment Length:531 Identity:178/532 (33%)
Similarity:271/532 (51%) Gaps:67/532 (13%)


  Rat    15 LWASVVILMVIVLKLFSLLLRRQK-LARAMDSFPGPPTHWLFGHALEIQKLGSLDKVVSWA---- 74
            :|.:::...:|:|..:....:||: ||....:.|||.:..:.|..|:...||: :.::.|.    
  Fly     1 MWLTLITGALILLLTWDFGRKRQRVLAFEKSAIPGPISIPILGCGLQALHLGA-ENIIGWVGEKF 64

  Rat    75 QQFPHAHPLWFGQFVGFLNIYEPD--YAKAVYS------RGDPKAADVYDFFLQWIGKGLLVLDG 131
            .::......|   .:|...||..|  |.:.:.|      :|     .:|::...::..||||..|
  Fly    65 DKYGKTFRFW---ILGESLIYTKDLQYFETILSSTTLLEKG-----QLYEYLRPFLNDGLLVSTG 121

  Rat   132 PKWFQHRKLLTPGFHYDVLKPYVAIFAESTRMMLDKWEKKASENKSFDIFCDVGHMALDTLMKCT 196
            .||...||:.|..||:.||:.||.|....:.:|:|...|.|....:.|:...|...|||.:.:..
  Fly   122 RKWHARRKIFTHAFHFKVLEHYVEIMDRHSSVMVDNLRKVADGKTAVDMLKYVSLAALDVITEAA 186

  Rat   197 FGKGDSGLGHRDNSYYLAVSDLTLLMQQRIDSF--QYHNDFIYWLTP------HGRRFLRACKIA 253
            .|...:.....|..|..|:..:..:...|:..|  :|:     ||.|      | |:.|...::.
  Fly   187 MGVQVNAQNDPDFPYIKALKSVVYIQPDRMFRFSRRYN-----WLFPLAAPLLH-RQLLSDIRVM 245

  Rat   254 HDHTDEVIRQRKAALQDEKE----------RKKIQQRRHLDFLDILLGVRDESGIK---LSDAEL 305
            ||.||:||.:|:..::..|.          ..:|..:..:..|||||    :|.|.   ||||::
  Fly   246 HDFTDKVISERRETVRRAKADGTYRPLSLGDAEIGSKSQMALLDILL----QSSINNQPLSDADI 306

  Rat   306 RAEVDTFMFEGHDTTTSGISWFLYCMALYPEHQQLCREEVRGILGDQDS-----FQWDDLAKMTY 365
            |.|||||||||.|||:||:|..||.:|.:||.||...||::.:||...|     .|..||   .|
  Fly   307 REEVDTFMFEGDDTTSSGVSHALYAIARHPEVQQRIFEELQRVLGPDASAPVTQAQLQDL---KY 368

  Rat   366 LTMCMKECFRLYPPVPQVYRQLNKPVTFVDGRSLPAGSLISLHIYALHRNSTVWPDPEVFDPLRF 430
            |...:||..|||||||.:.|...|.:...| :::||.:.|.|.:|..||::..:|||..|.|.||
  Fly   369 LDCVIKETMRLYPPVPAIGRHAQKELEIGD-KTIPANTSIYLVLYYAHRDANYFPDPLSFRPERF 432

  Rat   431 SPENAAGRHPFAFMPFSAGPRNCIGQQFAMNEMKVVTALCLLRFEFSLDPSKMPIKVPQL--ILR 493
            ..:...|.:.||::||||||:|||||:||:.||||:.:. :||| :.|.|....:| |.|  |||
  Fly   433 LEDQEQGHNTFAYVPFSAGPKNCIGQKFAVLEMKVLISK-VLRF-YELLPLGEELK-PMLNFILR 494

  Rat   494 SKNGIHLYLKP 504
            |.:||::.|:|
  Fly   495 SASGINVGLRP 505

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp4b1NP_058695.2 p450 47..500 CDD:278495 169/493 (34%)
Cyp4d20NP_647723.2 p450 34..493 CDD:278495 164/485 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C114653562
eggNOG 1 0.900 E2759_KOG0157
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.