DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp4b1 and Cyp6a8

Sequence 1:NP_058695.2 Gene:Cyp4b1 RGDID:2480 Length:511 Species:Rattus norvegicus
Sequence 2:NP_523749.2 Gene:Cyp6a8 FlyBaseID:FBgn0013772 Length:506 Species:Drosophila melanogaster

Alignment Length:551 Identity:129/552 (23%)
Similarity:228/552 (41%) Gaps:118/552 (21%)


  Rat    17 ASVVILMVIVLKLFSLL---LRRQKLARAMDSFPGPPTHWLFGHALEIQKLGSLDKVV-SWAQQF 77
            |...||..:.:.|.::|   :.|:.........|....|.:.|:..|:||..::.::. ....:|
  Fly     2 ALTYILFQVAVALLAILTYYIHRKLTYFKRRGIPFVAPHLIRGNMEELQKTKNIHEIFQDHYNKF 66

  Rat    78 PHAHPLWFGQFVGFLNIYEP----------------DYA----KAVY--SRGDPKAADVYDFFLQ 120
            ..:.    ..||||.....|                |::    |.::  .:.||.:|.:::    
  Fly    67 RESK----APFVGFFFFQSPAAFVIDLELAKQILIKDFSNFSNKGIFYNEKDDPISAHLFN---- 123

  Rat   121 WIGKGLLVLDGPKWFQHRKLLTPGFHYDVLK---PYVAIFAESTRMMLDKWEKKASENKSFDIFC 182
                    |||.:|...|..|:..|....:|   |.|...|.....::   .:|..:|...:|..
  Fly   124 --------LDGAQWRLLRNKLSSTFTSGKMKLMYPTVVSVANEFMTVM---HEKVPKNSVLEIRD 177

  Rat   183 DVGHMALDTLMKCTFGKGDSGLGHRDNSYYLAVSDLTLLMQQRIDSFQYHNDFIYWLTPHGRR-- 245
            .|....:|.:..|.||...:.|  ||..                      .:|:|:    |:|  
  Fly   178 LVARFTVDVIGTCAFGIQCNSL--RDEK----------------------AEFLYF----GKRSL 214

  Rat   246 -----------FLR-----ACKIAHDHTDEVIRQRKAALQDE----KERKKIQQRRHLDFLDILL 290
                       |:|     |.|:....|...|::..:.:..|    :|::.|::.   ||:|:|:
  Fly   215 VDKRHGTLLNGFMRSYPKLARKLGMVRTAPHIQEFYSRIVTETVAVREKEHIKRN---DFMDMLI 276

  Rat   291 GVRDESGIKLSDA---------ELRAEVDTFMFEGHDTTTSGISWFLYCMALYPEHQQLCREEVR 346
            .::::..:.|.:.         |:.|:...|...|.:|::|.:.:.||.:|..|:.|...|.||.
  Fly   277 ELKNQKEMTLENGDVVRGLTMEEVLAQAFVFFIAGFETSSSTMGFALYELAKNPDIQDKVRAEVE 341

  Rat   347 GILGDQD-SFQWDDLAKMTYLTMCMKECFRLYPPVPQVYRQLNKPVTFVDGRS---LPAGSLISL 407
            .::...| :|.::....:.||...:.|..|||..||.:.|...|... |.|..   :.||..:.:
  Fly   342 EVIEQHDQNFTYECTKDLKYLNQVLDETLRLYTIVPNLDRMAAKRYV-VPGHPNFVIEAGQSVII 405

  Rat   408 HIYALHRNSTVWPDPEVFDPLRFSPENAAGRHPFAFMPFSAGPRNCIGQQFAMNEMKVVTALCLL 472
            ...|:|.:.:::|:|..|.|.|||||.:|||...|::||..|||||||.:|...:.::..||.:.
  Fly   406 PSSAIHHDPSIYPEPFEFRPERFSPEESAGRPSVAWLPFGDGPRNCIGLRFGQMQARIGLALLIR 470

  Rat   473 RFEFSL---DPSKMPIKVPQLILRSKNGIHL 500
            .|:||.   .|:.:.......:|..|:||:|
  Fly   471 NFKFSTCSKTPNPLVYDPKSFVLGVKDGIYL 501

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp4b1NP_058695.2 p450 47..500 CDD:278495 122/517 (24%)
Cyp6a8NP_523749.2 p450 39..503 CDD:278495 122/515 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.