DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp1a1 and Cyp303a1

Sequence 1:NP_036672.2 Gene:Cyp1a1 RGDID:2458 Length:524 Species:Rattus norvegicus
Sequence 2:NP_001285977.1 Gene:Cyp303a1 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster

Alignment Length:512 Identity:142/513 (28%)
Similarity:219/513 (43%) Gaps:91/513 (18%)


  Rat    37 VPKGLKSPPGPWGLPFMGHVLTLGK--------------------NPHLSLTKLSQQYGDVLQIR 81
            |.|..:.||||...|.:|..|.:.:                    ||:       ..||    ::
  Fly    21 VRKPKRFPPGPAWYPIVGSALQVSQLRCRLGMFCKVIDVFARQYVNPY-------GFYG----LK 74

  Rat    82 IGSTPVVVLSGLNTIKQALVKQGDDFKGRPDLYSFTLIANGQSMTFNP------DSGPLWAARRR 140
            ||...||:....:.|.:.:.  .:|..||||...:.|      .|||.      ..|.:|..:||
  Fly    75 IGKDKVVIAYTNDAISEMMT--NEDIDGRPDGIFYRL------RTFNSRLGVLLTDGEMWVEQRR 131

  Rat   141 LAQNALKSFSIASDPTL-----ASSCYLEEHVSKEAEYLISKFQKLMAEVGHFDPFKYLVVSVAN 200
            .....||:|..|....:     .::|.|::        |..|..|...:....:......|.|.|
  Fly   132 FILRHLKNFGFARSGMMDIVHNEATCLLQD--------LKDKVLKSGGKQTRIEMHDLTSVYVLN 188

  Rat   201 VICAICFGRRYDHDDQELLSIVNLSNE-FGEVTGSGYPADFIPILRYL-PN-SSLDAFKDLNKKF 262
            .:..:..||||:....|:..::....| |..:...|......|:||:: || |..:.|.:.::..
  Fly   189 TLWCMLSGRRYEPGSPEITQLLETFFELFKNIDMVGALFSHFPLLRFIAPNFSGYNGFVESHRSL 253

  Rat   263 YSFMKKLIKEH---YRTFEKGHIRDITDSLIEHCQDRRLDENANVQLSDDKVITIVFDLFGAGFD 324
            |:||.|.|:.|   |:.:::.  ||:.||.: ..||...||..  ..||..::.|..|:|.||.:
  Fly   254 YTFMSKEIELHRLTYKNYDEP--RDLMDSYL-RAQDEGNDEKG--MFSDQSLLAICLDMFLAGSE 313

  Rat   325 TITTAISWSLMYLVTNPRIQRKIQEELDTVIGRDRQPRLS-DRPQLPYLEAFILETFRHSSFVPF 388
            |...::.:..|:||..|.||.:..:|:..|:|.:|.|..| ||.:|||.||..||..|......|
  Fly   314 TTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLPYCEAITLEAVRMFMLHTF 378

  Rat   389 TIPHSTIRDTSLNGFYIPKGHCV-------FVNQWQVNHDQELWGDPNEFRPERFLTSSGTLDKH 446
            .|||..:.||.|:|:.|||...|       .:|...       :.||..|.|:|:|     .|.|
  Fly   379 GIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVD-------FPDPESFNPDRYL-----FDGH 431

  Rat   447 LS--EKVILFGLGKRKCIGETIGRLEVFLFLAILLQQMEFNVSPGEKVDMTPAYGLT 501
            |.  |....||.|:.:|:|:.:||..:|:|...:||..:....||:..:..|..|.|
  Fly   432 LKLPEAFNPFGFGRHRCMGDLLGRQNLFMFTTTVLQNFKMVAIPGQVPEEVPLEGAT 488

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp1a1NP_036672.2 Mitochondrial targeting signal. {ECO:0000269|PubMed:19401463, ECO:0000269|PubMed:9348277} 33..44 2/7 (29%)
p450 44..496 CDD:278495 137/499 (27%)
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 137/496 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.833 Consistency score
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.