DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cpa1 and CG18585

Sequence 1:NP_058694.2 Gene:Cpa1 RGDID:2388 Length:419 Species:Rattus norvegicus
Sequence 2:NP_001260213.1 Gene:CG18585 FlyBaseID:FBgn0031929 Length:422 Species:Drosophila melanogaster

Alignment Length:430 Identity:148/431 (34%)
Similarity:244/431 (57%) Gaps:23/431 (5%)


  Rat     3 RLLILSLLLEAVCG--------NENFVGHQVLRISAADEAQVQKVKELEDLEHLQLDFWRDAARA 59
            |||.|...|.|:..        .|.:...:|.:::..::.|:..::::.:|.. :.:.|::....
  Fly     2 RLLWLLATLVALTSAGILKDSPKERYDNFRVYKLTIQNKIQLAAIEKIGELTK-KYNIWKEYDER 65

  Rat    60 GIPIDVRVPFPSIQSVKAFLEYHGISYEIMIEDVQLLLDEEKQQMSAFQARALSTDSFNYATYHT 124
            ...||:.|....:...:..|:::.||.|:|||:||..:|||:...:|..|      :|.:..|:.
  Fly    66 SRQIDIMVSPGELNHFQELLKFNNISSELMIENVQERIDEEQVTPTADSA------TFGWTKYYE 124

  Rat   125 LDEIYEFMDLLVAEHPQLVSKIQIGNTFEGRPIHVLKFSTGGTNRPAIWIDTGIHSREWVTQASG 189
            |:||..::|.::..:|.:..:..:|.::|||.|..:|.|....| |.|:|::.||:|||:|.||.
  Fly   125 LEEIEAWLDEILNAYPSVTEEFIVGKSYEGRTIRGIKISHKAGN-PGIFIESNIHAREWITSASA 188

  Rat   190 VWFAKKITKDYGQDPTFTAVLDNMDIFLEIVTNPDGFAYTHKTNRMWRKTRSHTQGSLCVGVDPN 254
            .||..::..  .:|....::.||.|..:..|.|.|||.|:||.:|||||||.....:.|:|.|.|
  Fly   189 TWFINQLLT--SEDADVRSLADNYDWHIIPVFNVDGFEYSHKKDRMWRKTRQPHATNACIGADAN 251

  Rat   255 RNWDA-GFGMAGASSNPCSETYRGKFPNSEVEVKSIVDFVTS-HGNIKAFISIHSYSQLLLYPYG 317
            ||:|: .....|||.||||||:.|..|.||.|.|::|:::|. ...|..:||.|||.|.||.|||
  Fly   252 RNFDSYWLQNNGASDNPCSETFAGDNPESEPEAKALVEYLTKIQDQISVYISFHSYGQYLLSPYG 316

  Rat   318 YTSEPAPDQ-AELDQLAKSAVTALTSL-HGTKFKYGSIIDTIYQASGSTIDWTYSQ-GIKYSFTF 379
            :|:|..|:. .::..:.|:...|:.:| :||.::|||..|.:|.|:|:::||.::: |.|..:|.
  Fly   317 HTNEEFPENYNDILTIGKAFADAIEALPYGTVYQYGSTADVLYVATGTSVDWVFNELGKKIGYTI 381

  Rat   380 ELRDTGLRGFLLPASQIIPTAEETWLALLTIMDHTVKHPY 419
            |.||.|..||:||..||||..||..:.:|.:::.|.:..|
  Fly   382 EYRDKGRYGFILPPVQIIPNCEELMVGMLALIEKTKELGY 421

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpa1NP_058694.2 Propep_M14 27..99 CDD:280416 16/72 (22%)
M14_CPA 117..417 CDD:133081 119/305 (39%)
Substrate binding. {ECO:0000250|UniProtKB:P00730} 179..182 2/3 (67%)
Substrate binding. {ECO:0000250|UniProtKB:P00730} 254..255 1/1 (100%)
Substrate binding. {ECO:0000250|UniProtKB:P00730} 307..308 1/1 (100%)
CG18585NP_001260213.1 Propep_M14 34..105 CDD:280416 16/72 (22%)
M14_CP_A-B_like 122..415 CDD:199844 117/296 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C69795422
eggNOG 1 0.900 E1_COG2866
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 262 1.000 Inparanoid score I2955
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
OrthoInspector 1 1.000 T131196
orthoMCL 1 0.900 OOG5_132369
Panther 1 1.100 O PTHR11705
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.890

Return to query results.
Submit another query.