DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cel and Gli

Sequence 1:NP_058693.2 Gene:Cel RGDID:2331 Length:612 Species:Rattus norvegicus
Sequence 2:NP_476602.1 Gene:Gli FlyBaseID:FBgn0001987 Length:956 Species:Drosophila melanogaster

Alignment Length:606 Identity:172/607 (28%)
Similarity:261/607 (43%) Gaps:133/607 (22%)


  Rat    50 IFKGIPFATAKTLEN----PQRHPGWQGTLKATDFKKRCLQATITQDDTYG----QEDCLYLNIW 106
            :|.|||:|...|.|.    |:.|.||| .|:|.||...|.|.......|.|    .|||||||::
  Fly   177 VFLGIPYALPPTFEGRFKPPRVHRGWQ-LLQAVDFGPACPQPVRYTGATKGIMDMDEDCLYLNVY 240

  Rat   107 VPQGRKQVSHDLPVMVWIYGGAFLMGSGQGANFLKNYLYDGEEIATRGNVIVVTFNYRVGPLGFL 171
            .|:....|:...||||:|:||.|:.|:..        |:.|..:|:..:|:|||.|||:|.||||
  Fly   241 SPKTGAGVAQKYPVMVYIHGGEFIRGASN--------LFQGHILASFYDVVVVTLNYRLGALGFL 297

  Rat   172 STGDANLPGNFGLRDQHMAIAWVKRNIAAFGGDPDNITIFGESAGAASVSLQTLSPYNKGLIRRA 236
            ||||.|.|||:|:.||.||:.||..||..|.||.::||:||..||.||..|..::|..:.::||.
  Fly   298 STGDENSPGNYGILDQAMALRWVYDNIEFFNGDRNSITLFGPGAGGASAGLLMVAPQTRNIVRRV 362

  Rat   237 ISQSGVALSPWAI------QENPLFWAKTIAKKVGCPTEDTAKMAGCLKITDPRALTLAYRLPLK 295
            |:|||.||:.||:      .:|.   ::.:.:.:||..|.:.|:..||:       |......|.
  Fly   363 IAQSGSALADWALIQDKYRAQNT---SRVLGQLLGCSIESSWKLVNCLR-------TGRSFYELG 417

  Rat   296 SQEY-PIVHYLAFIPVVDGDF-IPDDPINLYDN----------------------AADIDYLAGI 336
            :.|: |.|....:.||:|.:| :|.|  :.|:.                      ..:|.|:.|:
  Fly   418 NAEFSPQVGSFPWGPVLDHNFTLPGD--DWYEGWREKDWRFLTQTPETLIRAGKFNRNIQYMTGV 480

  Rat   337 N------------------DMDGHLFATVDVPAIDKAKQDVTEEDF---YRLVSGHTVAKGLKGT 380
            .                  ::||..|           .|.:.|..|   |.| :.:.|.:.:|  
  Fly   481 TTQEAAFFVAQNESLSPYYELDGRFF-----------DQKIREHVFRYNYTL-NPNGVYEAIK-- 531

  Rat   381 QATFDIYTESWAQDPSQENMKKTVVAFETDILFLIPTE----MALAQHRAHAKSAKTYSYLFSHP 441
                .||| .|....:...::...:...:|:.:..|.:    :.|.|      ....|.|:.:..
  Fly   532 ----YIYT-FWPDPNNNTIIRDQYINMLSDLYYRAPVDQMVKLMLEQ------KVPVYMYVLNTT 585

  Rat   442 SRMPIYPKWMGADHADDLQYVFGKPFAT----PLGYRAQ-------DRTVSKAMIAYWTNFAKSG 495
            ......|:|....|..:..::.|.||..    |.....|       ||.:|...:..:||||:.|
  Fly   586 VEALNLPQWRKYPHDIERYFLTGAPFMDTEFFPKKEHLQRNMWTDNDRNMSHFFMQTYTNFARYG 650

  Rat   496 DPNMGNSPVPTHWYPYTTENGNYLDINKKITSTSMKEHLREKFLKFWAVTFEMLPTVVGDHTPPE 560
            :|. ....:..|:.........||:||....|:.:..: |:....||.   :.||||:|...|  
  Fly   651 NPT-PQQVLGMHFQRAYQGEIRYLNINTTYNSSILLNY-RQTECAFW
T---QYLPTVIGVLVP-- 708

  Rat   561 DDSEAAPVPPTDDSQVVPVPP 581
                  ..|||.:....|..|
  Fly   709 ------TYPPTTEYWWEPKEP 723

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CelNP_058693.2 COesterase 26..542 CDD:278561 160/566 (28%)
Aes <118..>247 CDD:223730 62/129 (48%)
4 X 11 AA tandem repeats, O-glycosylated region 556..599 6/27 (22%)
GliNP_476602.1 COesterase 134..695 CDD:278561 160/566 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D754103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR43903
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
43.970

Return to query results.
Submit another query.