DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Atp8b4 and CG33298

Sequence 1:NP_001074413.2 Gene:Atp8b4 MGIID:1859664 Length:1194 Species:Mus musculus
Sequence 2:NP_995666.1 Gene:CG33298 FlyBaseID:FBgn0032120 Length:1517 Species:Drosophila melanogaster

Alignment Length:1339 Identity:404/1340 (30%)
Similarity:646/1340 (48%) Gaps:271/1340 (20%)


Mouse    17 KANDRDYNEKFQYADNRIHTSKYNVLTFLPINLFEQLQRVANAYFLFLLILQLIPEISSLTWFTT 81
            |...||: ...|:..|:|.|:||.:|:|:|.||.||..||||.||:|:::|..:||||:......
  Fly   239 KTPKRDH-PNGQFVGNKIRTTKYTLLSFIPKNLLEQFHRVANLYFIFIVLLNWVPEISAFGKEVA 302

Mouse    82 IVPLVLVISMTAVKDATDDYFRHKSDNQVNNRQSKVL--INSKLQNEKWMNVKVGDIIKLENNQF 144
            ::|::.|:.:|||||..:|..|..||.::||...:|.  ...:.:..||..::||||:.|.||:.
  Fly   303 MIPVLFVLGVTAVKDLFEDRRRRASDKRINNTTCRVYDGETERYKKVKWQELRVGDIVHLSNNET 367

Mouse   145 VAADLLLLSSSEPHGLCYVETAELDGETNLKVRQALPVTSELGADISSLAEFDGIVRCEAPNNKL 209
            |.||:|||.:|:|.|:||::|.:||||||||.|:.:....|: ..|...::|...|..:||..||
  Fly   368 VPADILLLRTSDPQGVCYIDTCDLDGETNLKRREVVRGFEEM-QSIFVPSKFVSRVEADAPTTKL 431

Mouse   210 DRFSGVLSWKDSKHA-LSNQKIILRGCVLRNTSWCFGMVLFAGPDTKLMQNSGKTKFKRTSIDRL 273
            .||.|.|.....:.. :|.:.::||...|:||.:..|:|::||.:||.|.|:...::||:.:::.
  Fly   432 YRFHGALIHPTGERVPISTECLLLRESRLKNTDYIEGIVVYAGHETKSMLNNSGPRYKRSQVEQQ 496

Mouse   274 MNTLVLWIFGFLVCLGIILAVG-----SSILESEVGDQFRTPPFWREGEKSFLFSGFLTFWSYVI 333
            ||..|:|....|:.|.::.|:|     ||.....|       |:....:.:........||:|::
  Fly   497 MNIDVIWCVIILLILCVVGAIGCRMWLSSFTHFPV-------PYLPPNKLTANMESMWIFWTYIV 554

Mouse   334 ILNTLVPISLYVSVEVIRLGHSYFINWDRKMYYASKAMPAEARTTTLNEELGQIEYIFSDKTGTL 398
            ||..::|:||||::|:.::...:.|:.:..::.|......|.|...:.||||||::||:||||||
  Fly   555 ILQVMIPLSLYVTIELCKILQVFHIHNNVDLFDAETNKQTECRAMNITEELGQIQHIFTDKTGTL 619

Mouse   399 TQNIMTFKKCSINGRVYAGEVLDDPIQKKEITKEKEATDFSSKSKSEKTLHFFDQSLMESIELGD 463
            |:|.|.|::|.:||..|     :.|..:.|....|..........::..     .|.|..:..|.
  Fly   620 TENKMIFRRCVVNGSDY-----NHPPSELEKIYSKPGAPAPPLIPNDNL-----NSDMAQLTQGT 674

Mouse   464 ------PKVHEFLRLLALCHTVM------------------------------------------ 480
                  .::.|||.:||:|:||:                                          
  Fly   675 YLTPHAQRIQEFLVVLAICNTVIVGAAPHRDMMNASGIIEVQQIGNSPANLKHGKQRQKLLASST 739

Mouse   481 ----------------------------------------------------------------- 480
                                                                             
  Fly   740 STTTTTTIINGPTTQPQVVSIPADRYIRLAESRSVTPSPPPNLLFALPAQSHQPTLSPISSSAES 804

Mouse   481 ---SEENSA-------------------------------------------------------- 486
               ||..|.                                                        
  Fly   805 SPNSESESPSPPMKNKSLSNSISPTGRAKAVINSKITSIATFLNAKTQGKRMKLPSSKTGTIYRT 869

Mouse   487 --GQLVYQVQSPDEGALVTAARNFGFIFKSRTPETITIE--ELGTPVTYQLLAFLDFNNIRKRMS 547
              |:.:|:.:||||.|||.||.::.....:|:|..|.:.  ..|....|::|..|.|::.||.||
  Fly   870 ADGRPLYEAESPDELALVNAAYSYDCCLLNRSPNQILVSMPMAGATREYEILKVLPFDSSRKCMS 934

Mouse   548 VIVRN-PEGRIKLYSKGADTILFEKLHPSNED-----LQSLTSDHLSEFAGEGLRTLAIAYRELD 606
            ::||. ....|.||:||||:.:...|.|.:.:     |:..|...|..:|.||||.|.:|.|.|:
  Fly   935 IVVRQIGSQEIVLYTKGADSSIMPVLVPCSHNSPEGILREQTQQLLDRYAREGLRILVMAKRTLN 999

Mouse   607 DKYFKMWQKMLEDANSATLERDERISGLYEEIERDLMLLGATAVEDKLQEGVIETITSLSLANIK 671
            ...:..|....::...:...|:.|:...:.::|.:|.|||||.:||:||:||.|||.||..|.|.
  Fly  1000 SADYTDWWARHQEIEMSLENRERRLRDSFAKLESNLTLLGATGIEDRLQDGVPETIASLLSAGIS 1064

Mouse   672 IWILTGDKQETAINIGYACNVLTDAMDALFVITGNTAGEVREELRKAKENLLGQSTSFSNGHA-V 735
            :|:|||||.||||||.|:..:.|..|: |..:|..:.......:.....::....|:.:.|:. .
  Fly  1065 VWVLTGDKPETAINIAYSAKLFTQQME-LIRLTARSRDAAETAINFYLTDMENDKTTSTLGYGQS 1128

Mouse   736 YDNKQRLGLDAGAGEAVTGEYALVINGHSLAHALE--SDVENDLLELACVCKTVVCCRVTPLQKA 798
            ...|||               |||::|.:|...|:  |.:....|.|:..|.:|:|||.||||||
  Fly  1129 LRKKQR---------------ALVVDGKTLTFILDPKSKLILPFLRLSKRCASVLCCRSTPLQKA 1178

Mouse   799 QVVELVKKHRNAVTLAIGDGANDVSMIKSAHIGIGISGQEGLQAVLASDYALAQFRYLQRLLLVH 863
            .:|::||:..|..||||||||||||||:.|.:|:|||||||:|||:|:|:.|.:||||:||||.|
  Fly  1179 YLVKVVKEELNLRTLAIGDGANDVSMIQMADVGVGISGQEGMQAVMAADFTLPRFRYLERLLLAH 1243

Mouse   864 GRWSYYRMCKFLCYFFYKNFAFTLVHFWFAFFCGFSAQTVYDQWFITLFNIVYTSLPVLAMGMFD 928
            |.|.|.|:.:.:.||||||.||..:.||:..:||||.|.:.||.::.|:|:::||||.||:|::|
  Fly  1244 GYWCYDRLSRMILYFFYKNAAFVFLIFWYQLYCGFSGQVMMDQMYLMLYNLIFTSLPPLAIGVYD 1308

Mouse   929 QDINEQNSMDYPQLYEPGQLNLLFNKRRFFICVAHGIYTSLALFFIPYGAFYNVAAEDGQHIADL 993
            :.:.|...:..|.||:.|:|.:.:....|::.:...:|.||.:||:...|:   |..|    ..:
  Fly  1309 KRVAEDLLLKNPYLYKNGRLGVAYRPHDFWLILLDALYQSLVIFFVALCAY---AESD----VGI 1366

Mouse   994 QSFAVTVATSLVIVVSIQIALDTSYWTVVNHVFIWGSVATYFSILLAMHSDGV----FGIFPRH- 1053
            ..|..|:..|.:....:..|::...|||::.:.|..|:.:::  |.|:..|.|    ||:...: 
  Fly  1367 WEFGTTITASCLFANLVHCAIEIRSWTVLHVLSIVLSLGSFY--LFAIVYDSVCMNCFGVRSSYW 1429

Mouse  1054 --FPFVGNARHSLSQKFVWLVVLLTAVTSVMPVVVVRFLKMYLYPSLSDQIRRWQKAQRKKRPLR 1116
              |....:|.|       |||::|:.|.:|:|.:::..:::.|.|..|.::           .|:
  Fly  1430 VIFVCFASAVH-------WLVIMLSTVVAVLPRLLLTTVRISLCPDDSTKV-----------ILQ 1476

Mouse  1117 SRRPQTR---------RSSSRRSGYAFAHQEGYGELITS 1146
            |:|.::|         ||:|..|.|.........::||:
  Fly  1477 SKRERSRGEALLVTWSRSTSASSIYRITDYGSKNQIITT 1515

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Atp8b4NP_001074413.2 P-type_ATPase_APLT_Dnf-like 31..975 CDD:319770 358/1137 (31%)
CG33298NP_995666.1 PhoLip_ATPase_N 249..299 CDD:292826 25/50 (50%)
ATPase-Plipid 250..1473 CDD:273734 389/1273 (31%)
E1-E2_ATPase 302..>394 CDD:278548 38/92 (41%)
Cation_ATPase <880..965 CDD:289987 32/85 (38%)
HAD_like <1177..1240 CDD:304363 41/63 (65%)
PhoLip_ATPase_C 1223..1468 CDD:292829 86/261 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0474
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D587717at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.