DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tlr2 and Tl

Sequence 1:XP_006501523.1 Gene:Tlr2 MGIID:1346060 Length:794 Species:Mus musculus
Sequence 2:NP_001262995.1 Gene:Tl FlyBaseID:FBgn0262473 Length:1117 Species:Drosophila melanogaster

Alignment Length:949 Identity:212/950 (22%)
Similarity:347/950 (37%) Gaps:320/950 (34%)


Mouse    50 SRSFTSIPSGLTAAMKSLDLSFNKITYIGHGDLRACANLQVLMLKSSRINTIEGDAFYSLGSLEH 114
            :|..|.||:.|...|::|          .|.:|||            .|..:....|..|.:||.
  Fly   159 TRRLTHIPANLLTDMRNL----------SHLELRA------------NIEEMPSHLFDDLENLES 201

Mouse   115 LDLSDNHLSSLSSSWFGPLSSLKYLNLMGNPYQTL------GVTS-----------------LFP 156
            ::...|.|..:....||.:..||.|||..|....|      |.||                 :|.
  Fly   202 IEFGSNKLRQMPRGIFGKMPKLKQLNLWSNQLHNLTKHDFEGATSVLGIDIHDNGIEQLPHDVFA 266

Mouse   157 NLTNLQTLRIG-------------NVETFSEIR----RIDFAGLTS---LNELEIKALSLRNYQS 201
            :|||:..:.:.             :.:..:|:|    |:..|.|.|   .|:.|::.|.|| .:.
  Fly   267 HLTNVTDINLSANLFRSLPQGLFDHNKHLNEVRLMNNRVPLATLPSRLFANQPELQILRLR-AEL 330

Mouse   202 QSLKSIRDI-HHLT----LHLSES------AFLLEIFADILSSVRYLELRDTNLARFQFSPLPVD 255
            |||..  |: .|.|    :.|.::      |.|||...::||    |:|.:..|.....|     
  Fly   331 QSLPG--DLFEHSTQITNISLGDNLLKTLPATLLEHQVNLLS----LDLSNNRLTHLPDS----- 384

Mouse   256 EVSSPMKKLAFRGSVLTDESFNELLKLLRYILELSEVEFDDCTLNGLGDFNPSESDVVSELGKVE 320
                                      |..:...|:::..:|..|.|:      ..|:.|.||.:.
  Fly   385 --------------------------LFAHTTNLTDLRLEDNLLTGI------SGDIFSNLGNLV 417

Mouse   321 TVT-------------------IRRLHIP-----------QFYLFYDLSTVYSLLEKVKRITVEN 355
            |:.                   :|.||:.           ...|...:::.:..:..:..:.:.|
  Fly   418 TLVMSRNRLRTIDSRAFVSTNGLRHLHLDHNDIDLQQPLLDIMLQTQINSPFGYMHGLLTLNLRN 482

Mouse   356 SKVFLVPCSFSQHLKSLEFLDLSENLMVEEYLKNSACKGAWPSLQTLVLSQNHLR---SMQKTGE 417
            :.:..|...:...:..|..||||.|        |.:..| :..|  ..||||.|.   :..|...
  Fly   483 NSIIFVYNDWKNTMLQLRELDLSYN--------NISSLG-YEDL--AFLSQNRLHVNMTHNKIRR 536

Mouse   418 ILLT---------LKNLTSLDISRNTFHPMPDSCQ--W----------PEKMRFLN--------- 452
            |.|.         ..||..:|::.|   |:...|.  |          |:..|...         
  Fly   537 IALPEDVHLGEGYNNNLVHVDLNDN---PLVCDCTILWFIQLVRGVHKPQYSRQFKLRTDRLVCS 598

Mouse   453 ----LSSTGIRVVKTCIPQTLEV-LDVSNN-----------------------NLDSFSL-FLPR 488
                |..|.:|.::   ||||.. ||.|::                       |..|.:| .:||
  Fly   599 QPNVLEGTPVRQIE---PQTLICPLDFSDDPRERKCPRGCNCHVRTYDKALVINCHSGNLTHVPR 660

Mouse   489 ---------LQELYISRNKLKTLPDASL--FPVLLVMKIRENAVSTFSKDQLG--------SFPK 534
                     |.||::..|.|..||.|:.  :..:..:.:..|.:::...|||.        |:..
  Fly   661 LPNLHKNMQLMELHLENNTLLRLPSANTPGYESVTSLHLAGNNLTSIDVDQLPTNLTHLDISWNH 725

Mouse   535 LETLEA-----------------GDNHFVCSC---ELLSFTMETPALAQILVDWPDSYLC---DS 576
            |:.|.|                 ..|.::|.|   .||.||.:.   .:.:.| .:..:|   :.
  Fly   726 LQMLNATVLGFLNRTMKWRSVKLSGNPWMCDCTAKPLLLFTQDN---FERIGD-RNEMMCVNAEM 786

Mouse   577 PPRLHGHRLQDARPSVLECHQAALVSGVCCALLLLILLVGALCHHFHGLWY-----LRMMWAWLQ 636
            |.|:......|..|:         ..||..||.::|.|.|.|......|:|     :::   ||.
  Fly   787 PTRMVELSTNDICPA---------EKGVFIALAVVIALTGLLAGFTAALYYKFQTEIKI---WLY 839

Mouse   637 AKR------------KPKKAPCRDVCYDAFVSYSEQDSHWVENLMVQQLENSDPPFKLCLHKRDF 689
            |..            |.||       :|||:|||.:|..::|:.:|.|||:....|:||:|:||:
  Fly   840 AHNLLLWFVTEEDLDKDKK-------FDAFISYSHKDQSFIEDYLVPQLEHGPQKFQLCVHERDW 897

Mouse   690 VPGKWIIDNIIDSIEKSHKTVFVLSENFVRSEWCKYELDFSHFRLFDENNDAAILVLLEPI-ERK 753
            :.|..|.:||:.|:..|.:|:.|||:||::|||.:.|...:|....:|.....|:::...| :.:
  Fly   898 LVGGHIPENIMRSVADSRRTIIVLSQNFIKSEWARLEFRAAHRSALNEGRSRIIVIIYSDIGDVE 962

Mouse   754 AIPQRFCKLRKIMNTKTYLEWPLDEGQQEVFWVNLRTAI 792
            .:.:   :|:..:...|||:|     ....||..||.|:
  Fly   963 KLDE---ELKAYLKMNTYLKW-----GDPWFWDKLRFAL 993

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tlr2XP_006501523.1 LRR_RI <65..161 CDD:238064 28/119 (24%)
leucine-rich repeat 65..87 CDD:275378 5/22 (23%)
LRR_8 87..145 CDD:290566 15/58 (26%)
leucine-rich repeat 88..111 CDD:275378 3/23 (13%)
leucine-rich repeat 112..135 CDD:275378 6/23 (26%)
leucine-rich repeat 136..160 CDD:275378 13/47 (28%)
leucine-rich repeat 186..212 CDD:275380 9/27 (33%)
leucine-rich repeat 213..233 CDD:275380 8/30 (27%)
LRR_RI 261..513 CDD:238064 65/355 (18%)
leucine-rich repeat 372..398 CDD:275380 8/26 (31%)
leucine-rich repeat 399..424 CDD:275380 9/37 (24%)
LRR_8 423..499 CDD:290566 28/135 (21%)
leucine-rich repeat 448..468 CDD:275380 6/33 (18%)
LRR_4 469..504 CDD:289563 16/69 (23%)
leucine-rich repeat 469..488 CDD:275380 8/44 (18%)
LRR_8 487..545 CDD:290566 19/94 (20%)
leucine-rich repeat 489..510 CDD:275380 8/23 (35%)
leucine-rich repeat 511..534 CDD:275380 5/31 (16%)
TPKR_C2 543..596 CDD:301599 13/59 (22%)
TIR 650..794 CDD:214587 48/145 (33%)
TlNP_001262995.1 LRR_8 174..233 CDD:290566 20/81 (25%)
leucine-rich repeat 176..198 CDD:275380 8/44 (18%)
leucine-rich repeat 199..222 CDD:275380 6/23 (26%)
LRR_RI 216..542 CDD:238064 77/381 (20%)
LRR_8 221..281 CDD:290566 14/60 (23%)
leucine-rich repeat 223..270 CDD:275380 13/47 (28%)
leucine-rich repeat 271..294 CDD:275380 0/23 (0%)
leucine-rich repeat 295..320 CDD:275380 7/25 (28%)
leucine-rich repeat 321..343 CDD:275380 9/25 (36%)
LRR_8 342..402 CDD:290566 15/95 (16%)
leucine-rich repeat 344..367 CDD:275380 5/23 (22%)
leucine-rich repeat 368..391 CDD:275380 7/58 (12%)
LRR_8 390..450 CDD:290566 12/66 (18%)
leucine-rich repeat 392..415 CDD:275380 8/29 (28%)
leucine-rich repeat 416..439 CDD:275380 1/23 (4%)
leucine-rich repeat 440..474 CDD:275380 4/34 (12%)
leucine-rich repeat 475..498 CDD:275380 2/23 (9%)
LRR_8 477..534 CDD:290566 17/68 (25%)
leucine-rich repeat 499..520 CDD:275380 9/32 (28%)
leucine-rich repeat 523..552 CDD:275380 5/29 (17%)
LRRCT 561..619 CDD:214507 13/64 (20%)
LRRNT 631..667 CDD:214470 5/36 (14%)
leucine-rich repeat 664..693 CDD:275380 8/29 (28%)
LRR_8 669..726 CDD:290566 13/57 (23%)
leucine-rich repeat 694..715 CDD:275380 4/21 (19%)
leucine-rich repeat 716..737 CDD:275380 4/21 (19%)
LRRCT 751..800 CDD:214507 12/53 (23%)
TIR 858..996 CDD:214587 49/152 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D147327at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24365
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.